Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEH6CAO)

DME Name Gamma-glutamyltranspeptidase 5 (GGT5)
Synonyms
Glutathione hydrolase 5 proenzyme; Gamma-glutamyl transpeptidase-related enzyme; Gamma-glutamyltransferase 5; Gamma-glutamyltransferase-like activity 1; Glutathione hydrolase 5 heavy chain; Glutathione hydrolase 5 light chain; GGT 5; GGT-rel; GGT5; GGTLA1
Gene Name GGT5
UniProt ID
GGT5_HUMAN
INTEDE ID
DME0432
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2687
EC Number EC: 3.4.19.13
Hydrolases
Peptidase
Omega peptidase
EC: 3.4.19.13
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MARGYGATVSLVLLGLGLALAVIVLAVVLSRHQAPCGPQAFAHAAVAADSKVCSDIGRAI
LQQQGSPVDATIAALVCTSVVNPQSMGLGGGVIFTIYNVTTGKVEVINARETVPASHAPS
LLDQCAQALPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLRGGHVVAPVL
SRFLHNSILRPSLQASTLRQLFFNGTEPLRPQDPLPWPALATTLETVATEGVEVFYTGRL
GQMLVEDIAKEGSQLTLQDLAKFQPEVVDALEVPLGDYTLYSPPPPAGGAILSFILNVLR
GFNFSTESMARPEGRVNVYHHLVETLKFAKGQRWRLGDPRSHPKLQNASRDLLGETLAQL
IRQQIDGRGDHQLSHYSLAEAWGHGTGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRT
GIILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKA
QGSKLVIGGAGGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSKGCVEYEPNFSQEV
QRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY
Function This enzyme cleaves the gamma-glutamyl peptide bond of glutathione conjugates, but maybe not glutathione itself. It converts leukotriene C4 (LTC4) to leukotriene D4 (LTD4).
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Glutathione metabolism (hsa00480 )
Metabolic pathways (hsa01100 )
Taurine and hypotaurine metabolism (hsa00430 )
Reactome Pathway
Glutathione synthesis and recycling (R-HSA-174403 )
Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691 )
Aflatoxin activation and detoxification (R-HSA-5423646 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Glutathione DMAHMT9 Human immunodeficiency virus infection 1C62 Approved [1]
2 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Glutathione ester DMAV2I7 Discovery agent N.A. Investigative [1]
LTC4 DM702WR Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
LTC4 Discovery agent [N.A.] Investigative Km = 0.0102 microM [1]
Glutathione Human immunodeficiency virus infection [1C62] Approved Km = 0.0105 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.62E-30 4.61E-01 1.25E+00
Alopecia ED70 Skin from scalp 2.09E-01 1.86E-02 4.33E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.15E-02 2.08E-01 5.14E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.74E-01 2.60E-02 1.59E-01
Aortic stenosis BB70 Calcified aortic valve 1.27E-01 5.07E-01 6.94E-01
Apnea 7A40 Hyperplastic tonsil 5.76E-01 1.51E-02 7.51E-02
Arthropathy FA00-FA5Z Peripheral blood 1.41E-03 2.09E-01 1.18E+00
Asthma CA23 Nasal and bronchial airway 1.34E-02 -6.25E-02 -1.70E-01
Atopic dermatitis EA80 Skin 2.85E-04 3.46E-01 1.01E+00
Autism 6A02 Whole blood 1.56E-01 4.88E-02 1.75E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.02E-01 -1.81E-01 -1.11E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.33E-02 5.63E-01 2.10E+00
Bacterial infection of gingival 1C1H Gingival tissue 3.34E-13 4.88E-01 1.30E+00
Batten disease 5C56.1 Whole blood 4.30E-01 1.50E-01 8.83E-01
Behcet's disease 4A62 Peripheral blood 6.12E-01 -5.60E-02 -1.96E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.44E-01 -3.38E-02 -1.32E-01
Bladder cancer 2C94 Bladder tissue 8.53E-01 -5.83E-02 -9.50E-02
Breast cancer 2C60-2C6Z Breast tissue 4.32E-13 -3.30E-01 -5.47E-01
Cardioembolic stroke 8B11.20 Whole blood 2.11E-01 -9.90E-02 -2.80E-01
Cervical cancer 2C77 Cervical tissue 5.32E-01 1.76E-01 5.69E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.21E-01 4.80E-02 8.33E-02
Chronic hepatitis C 1E51.1 Whole blood 7.67E-01 -1.36E-01 -9.12E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.59E-01 -7.97E-02 -1.93E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.35E-03 1.38E-01 5.22E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.50E-01 1.56E-01 7.53E-01
Colon cancer 2B90 Colon tissue 9.12E-02 -1.57E-02 -4.10E-02
Coronary artery disease BA80-BA8Z Peripheral blood 8.75E-01 -1.20E-01 -6.93E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.91E-01 -8.02E-02 -2.37E-01
Endometriosis GA10 Endometrium tissue 1.34E-01 -2.08E-02 -4.72E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.56E-01 -4.45E-02 -1.84E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.18E-05 -2.34E-01 -1.06E+00
Gastric cancer 2B72 Gastric tissue 1.97E-01 2.96E-01 1.04E+00
Glioblastopma 2A00.00 Nervous tissue 2.25E-30 3.50E-01 7.10E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.56E-01 5.09E-01 8.47E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.70E-01 1.96E-02 3.73E-02
Head and neck cancer 2D42 Head and neck tissue 7.52E-29 7.87E-01 1.59E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.89E-04 2.15E-01 1.18E+00
Huntington's disease 8A01.10 Whole blood 8.40E-01 3.89E-02 1.45E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.40E-01 9.80E-02 9.88E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.38E-01 -1.08E-02 -1.05E-01
Influenza 1E30 Whole blood 4.69E-01 1.30E-01 1.55E+00
Interstitial cystitis GC00.3 Bladder tissue 1.98E-02 6.66E-01 1.86E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.93E-02 7.07E-01 8.87E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.34E-01 -1.01E-01 -1.97E-01
Ischemic stroke 8B11 Peripheral blood 3.60E-01 -2.77E-03 -2.02E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 5.64E-01 2.69E-02 6.64E-02
Lateral sclerosis 8B60.4 Skin 3.44E-01 1.86E-01 7.52E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.54E-01 9.96E-02 2.76E-01
Liver cancer 2C12.0 Liver tissue 2.54E-19 -1.23E+00 -2.54E+00
Liver failure DB99.7-DB99.8 Liver tissue 6.24E-04 1.43E+00 3.35E+00
Lung cancer 2C25 Lung tissue 1.82E-04 1.29E-01 2.72E-01
Lupus erythematosus 4A40 Whole blood 1.58E-02 -5.71E-02 -1.51E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.84E-02 -7.35E-03 -3.80E-02
Major depressive disorder 6A70-6A7Z Whole blood 6.11E-01 -4.76E-02 -1.74E-01
Melanoma 2C30 Skin 9.07E-01 -2.07E-01 -1.85E-01
Multiple myeloma 2A83.1 Peripheral blood 7.42E-01 -1.26E-01 -5.18E-01
Multiple myeloma 2A83.1 Bone marrow 2.38E-03 2.28E-01 1.57E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.86E-01 -3.58E-02 -1.97E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.91E-01 -3.79E-02 -2.60E-01
Myelofibrosis 2A20.2 Whole blood 8.57E-02 -2.10E-02 -2.82E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.93E-02 2.51E-01 6.40E-01
Myopathy 8C70.6 Muscle tissue 1.54E-01 1.84E-01 1.16E+00
Neonatal sepsis KA60 Whole blood 1.60E-01 5.71E-03 1.88E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.95E-05 -5.25E-01 -2.36E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.11E-01 -2.05E-01 -6.25E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.02E-01 1.64E-01 5.34E-01
Olive pollen allergy CA08.00 Peripheral blood 1.99E-01 1.35E-01 6.54E-01
Oral cancer 2B6E Oral tissue 2.34E-01 1.60E-01 3.15E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.28E-01 8.10E-01 6.62E-01
Osteoporosis FB83.1 Bone marrow 6.79E-01 -3.16E-01 -4.31E-01
Ovarian cancer 2C73 Ovarian tissue 4.28E-01 -4.11E-01 -7.97E-01
Pancreatic cancer 2C10 Pancreas 7.93E-05 6.86E-01 1.37E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 6.65E-02 -4.68E-01 -9.61E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.42E-01 2.36E-02 1.62E-01
Pituitary cancer 2D12 Pituitary tissue 1.12E-02 -4.18E-01 -9.64E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.18E-02 -5.90E-01 -1.36E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.18E-01 6.38E-03 5.54E-02
Polycythemia vera 2A20.4 Whole blood 8.42E-02 1.25E-02 1.21E-01
Pompe disease 5C51.3 Biceps muscle 1.76E-03 8.54E-01 2.34E+00
Preterm birth KA21.4Z Myometrium 9.65E-02 -2.99E-01 -7.62E-01
Prostate cancer 2C82 Prostate 9.18E-01 4.15E-01 5.35E-01
Psoriasis EA90 Skin 4.64E-05 -3.06E-01 -6.94E-01
Rectal cancer 2B92 Rectal colon tissue 2.72E-01 1.41E-01 5.19E-01
Renal cancer 2C90-2C91 Kidney 2.72E-01 -5.77E-01 -6.79E-01
Retinoblastoma 2D02.2 Uvea 1.39E-03 5.89E-01 2.91E+00
Rheumatoid arthritis FA20 Synovial tissue 5.62E-04 1.52E+00 3.07E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.27E-01 -1.41E-02 -9.54E-02
Schizophrenia 6A20 Prefrontal cortex 7.98E-01 -5.27E-03 -1.87E-02
Schizophrenia 6A20 Superior temporal cortex 6.15E-01 1.27E-01 4.85E-01
Scleroderma 4A42.Z Whole blood 1.73E-03 1.78E-01 1.55E+00
Seizure 8A60-8A6Z Whole blood 6.91E-01 -1.01E-01 -3.49E-01
Sensitive skin EK0Z Skin 3.32E-01 1.16E-01 5.26E-01
Sepsis with septic shock 1G41 Whole blood 2.88E-15 2.01E-01 7.81E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.79E-02 1.83E-01 1.14E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.12E-01 4.49E-02 1.42E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.78E-01 -2.41E-01 -1.32E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.55E-01 -3.19E-02 -1.94E-01
Skin cancer 2C30-2C3Z Skin 1.05E-26 -6.51E-01 -1.27E+00
Thrombocythemia 3B63 Whole blood 8.12E-01 -2.78E-02 -3.25E-01
Thrombocytopenia 3B64 Whole blood 6.75E-01 1.36E-01 2.95E-01
Thyroid cancer 2D10 Thyroid 2.13E-01 8.12E-02 1.87E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.55E-03 3.56E-01 8.61E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.82E-02 1.48E+00 1.49E+01
Type 2 diabetes 5A11 Liver tissue 3.70E-01 -3.23E-01 -7.78E-01
Ureter cancer 2C92 Urothelium 2.83E-01 -1.52E-02 -5.70E-02
Uterine cancer 2C78 Endometrium tissue 5.36E-11 -3.05E-01 -3.76E-01
Vitiligo ED63.0 Skin 1.97E-01 -1.22E-01 -2.68E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Gamma-glutamyl compounds: substrate specificity of gamma-glutamyl transpeptidase enzymes. Anal Biochem. 2011 Jul 15;414(2):208-14.