Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEH6S1Q)

DME Name CDP-choline phosphohydrolase (ADPRM)
Synonyms Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase; ADPRibase-Mn; ADPRM; C17orf48; MDS006; Nbla03831
Gene Name ADPRM
UniProt ID
ADPRM_HUMAN
INTEDE ID
DME0517
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
56985
EC Number EC: 3.6.1.53
Hydrolases
Acid anhydride hydrolase
Acid anhydride hydrolase
EC: 3.6.1.53
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWN
NESSMPCCVLQLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREY
LTHSKLNTKFLEDQIVHHPETMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKY
EQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVS
HLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTHDGGYSEDPFGVYHVNLEGVI
ETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC
Function This enzyme hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose.
KEGG Pathway
Glycerophospholipid metabolism (hsa00564 )
Metabolic pathways (hsa01100 )
Purine metabolism (hsa00230 )
Reactome Pathway
Phosphate bond hydrolysis by NUDT proteins (R-HSA-2393930 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Citicoline DMI4XBM Cerebrovascular ischaemia 8B1Z Approved [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Citicoline Cerebrovascular ischaemia [8B1Z] Approved Km = 0.35 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.11E-16 5.32E-01 1.22E+00
Alopecia ED70 Skin from scalp 4.91E-08 2.53E-01 1.33E+00
Alzheimer's disease 8A20 Entorhinal cortex 2.04E-03 -7.81E-02 -4.52E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.33E-01 -5.04E-02 -4.02E-01
Aortic stenosis BB70 Calcified aortic valve 4.91E-02 -1.74E-01 -6.39E-01
Apnea 7A40 Hyperplastic tonsil 6.06E-01 1.55E-02 1.13E-01
Arthropathy FA00-FA5Z Peripheral blood 3.65E-01 -1.21E-01 -3.29E-01
Asthma CA23 Nasal and bronchial airway 4.03E-08 4.43E-01 1.05E+00
Atopic dermatitis EA80 Skin 1.23E-07 -3.59E-01 -1.77E+00
Autism 6A02 Whole blood 8.17E-01 5.85E-02 1.01E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.47E-01 -3.99E-01 -1.12E+00
Autosomal dominant monocytopenia 4B04 Whole blood 9.98E-01 -1.03E-01 -1.92E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.83E-03 -6.23E-02 -2.03E-01
Batten disease 5C56.1 Whole blood 9.81E-02 -1.41E-01 -7.01E-01
Behcet's disease 4A62 Peripheral blood 3.31E-01 -1.31E-01 -4.45E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.85E-01 -3.18E-02 -1.58E-01
Bladder cancer 2C94 Bladder tissue 6.96E-05 -8.65E-01 -3.40E+00
Breast cancer 2C60-2C6Z Breast tissue 5.57E-09 -1.32E-01 -3.90E-01
Cardioembolic stroke 8B11.20 Whole blood 6.79E-01 -1.75E-02 -5.30E-02
Cervical cancer 2C77 Cervical tissue 3.28E-02 1.41E-01 5.18E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.22E-01 -1.60E-01 -2.21E-01
Chronic hepatitis C 1E51.1 Whole blood 5.49E-01 -3.65E-02 -1.10E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.46E-01 1.73E-02 7.95E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.95E-02 -1.28E-01 -4.24E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.67E-01 1.71E-01 9.24E-01
Colon cancer 2B90 Colon tissue 1.77E-02 8.14E-02 2.55E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.85E-01 3.53E-01 4.59E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.55E-01 -3.76E-01 -9.02E-01
Endometriosis GA10 Endometrium tissue 1.08E-01 -3.21E-01 -5.47E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.82E-01 5.47E-03 1.80E-02
Familial hypercholesterolemia 5C80.00 Whole blood 3.03E-02 1.77E-01 5.58E-01
Gastric cancer 2B72 Gastric tissue 6.34E-01 -1.78E-01 -3.77E-01
Glioblastopma 2A00.00 Nervous tissue 1.53E-55 3.07E-01 1.06E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.71E-01 5.70E-01 1.04E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.38E-02 6.52E-01 1.09E+00
Head and neck cancer 2D42 Head and neck tissue 8.13E-01 -5.01E-03 -1.71E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.67E-02 -6.41E-02 -5.64E-01
Huntington's disease 8A01.10 Whole blood 9.42E-01 7.31E-02 1.52E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.44E-01 -7.06E-04 -2.07E-03
Immunodeficiency 4A00-4A20 Peripheral blood 8.72E-02 -1.51E-01 -7.84E-01
Influenza 1E30 Whole blood 6.70E-02 -5.86E-01 -5.39E+00
Interstitial cystitis GC00.3 Bladder tissue 1.58E-02 -1.47E-01 -1.63E+00
Intracranial aneurysm 8B01.0 Intracranial artery 6.17E-01 -1.52E-01 -5.86E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.60E-01 -7.42E-02 -4.32E-01
Ischemic stroke 8B11 Peripheral blood 3.82E-01 1.49E-02 4.12E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.12E-01 -7.71E-02 -1.49E-01
Lateral sclerosis 8B60.4 Skin 5.61E-02 -2.27E-01 -1.11E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 8.98E-01 -4.86E-02 -2.04E-01
Liver cancer 2C12.0 Liver tissue 7.34E-01 -1.53E-01 -2.76E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.21E-01 1.90E-01 5.17E-01
Lung cancer 2C25 Lung tissue 5.97E-15 -2.64E-01 -7.23E-01
Lupus erythematosus 4A40 Whole blood 6.92E-01 9.82E-03 1.68E-02
Major depressive disorder 6A70-6A7Z Hippocampus 7.07E-02 1.19E-01 6.56E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.18E-02 -1.31E-01 -3.98E-01
Melanoma 2C30 Skin 8.02E-01 9.80E-03 1.60E-02
Multiple myeloma 2A83.1 Peripheral blood 7.89E-01 1.64E-02 4.36E-02
Multiple myeloma 2A83.1 Bone marrow 7.14E-03 -3.07E-01 -1.52E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.26E-01 -2.84E-02 -5.35E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.35E-02 -1.30E-01 -3.51E-01
Myelofibrosis 2A20.2 Whole blood 4.77E-04 -1.73E-01 -9.52E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.33E-01 -2.22E-01 -3.78E-01
Myopathy 8C70.6 Muscle tissue 2.69E-02 3.14E-01 9.00E-01
Neonatal sepsis KA60 Whole blood 4.30E-03 -3.18E-01 -4.91E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.80E-08 1.22E+00 3.98E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.56E-01 1.50E-01 2.46E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.93E-01 -3.92E-02 -9.64E-02
Olive pollen allergy CA08.00 Peripheral blood 6.87E-01 4.80E-02 9.80E-02
Oral cancer 2B6E Oral tissue 1.62E-02 9.07E-02 2.51E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.28E-01 1.36E-01 2.51E-01
Osteoporosis FB83.1 Bone marrow 6.28E-01 -3.33E-01 -3.45E+00
Ovarian cancer 2C73 Ovarian tissue 2.17E-02 -5.50E-01 -1.17E+00
Pancreatic cancer 2C10 Pancreas 5.97E-01 -8.63E-03 -2.08E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 2.16E-01 -1.49E-01 -4.53E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.93E-01 -1.21E-01 -5.27E-01
Pituitary cancer 2D12 Pituitary tissue 4.85E-02 2.95E-01 7.06E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.44E-04 3.12E-01 1.54E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.01E-01 1.81E-01 7.30E-01
Polycythemia vera 2A20.4 Whole blood 5.22E-12 -4.18E-01 -2.09E+00
Pompe disease 5C51.3 Biceps muscle 3.38E-02 -1.98E-01 -6.26E-01
Preterm birth KA21.4Z Myometrium 9.30E-01 -1.97E-02 -5.68E-02
Prostate cancer 2C82 Prostate 8.38E-01 2.20E-01 3.38E-01
Psoriasis EA90 Skin 7.93E-04 -6.09E-02 -1.26E-01
Rectal cancer 2B92 Rectal colon tissue 3.38E-03 -7.38E-01 -2.42E+00
Renal cancer 2C90-2C91 Kidney 4.19E-03 6.90E-01 1.29E+00
Retinoblastoma 2D02.2 Uvea 3.06E-05 -1.09E+00 -2.27E+00
Rheumatoid arthritis FA20 Synovial tissue 2.92E-03 5.48E-01 1.33E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.01E-01 3.13E-02 2.37E-01
Schizophrenia 6A20 Prefrontal cortex 1.62E-01 -2.70E-02 -3.01E-02
Schizophrenia 6A20 Superior temporal cortex 6.47E-01 -1.09E-02 -1.00E-01
Scleroderma 4A42.Z Whole blood 3.10E-01 -1.42E-02 -4.62E-02
Seizure 8A60-8A6Z Whole blood 3.31E-03 6.30E-01 1.66E+00
Sensitive skin EK0Z Skin 4.39E-02 -1.41E-01 -1.33E+00
Sepsis with septic shock 1G41 Whole blood 9.74E-15 -4.85E-01 -8.42E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.76E-02 -7.32E-01 -1.26E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.38E-03 -2.38E-01 -8.07E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.87E-01 1.25E-01 1.80E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.60E-01 -1.58E-01 -1.96E+00
Skin cancer 2C30-2C3Z Skin 1.95E-03 -1.04E-01 -2.86E-01
Thrombocythemia 3B63 Whole blood 1.38E-03 -1.39E-01 -7.46E-01
Thrombocytopenia 3B64 Whole blood 8.99E-01 -2.04E-01 -4.11E-01
Thyroid cancer 2D10 Thyroid 4.05E-04 -2.14E-01 -5.02E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.73E-02 -9.51E-02 -3.45E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.98E-03 -3.40E-01 -3.67E+00
Type 2 diabetes 5A11 Liver tissue 1.07E-01 1.60E-01 1.35E+00
Ureter cancer 2C92 Urothelium 7.10E-01 5.83E-02 5.26E-01
Uterine cancer 2C78 Endometrium tissue 1.42E-04 -1.22E-01 -2.50E-01
Vitiligo ED63.0 Skin 2.66E-03 -1.25E-01 -1.54E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Molecular bases of catalysis and ADP-ribose preference of human Mn2+-dependent ADP-ribose/CDP-alcohol diphosphatase and conversion by mutagenesis to a preferential cyclic ADP-ribose phosphohydrolase. PLoS One. 2015 Feb 18;10(2):e0118680.