General Information of Drug-Metabolizing Enzyme (DME) (ID: DEH7XYP)

DME Name Glutathione S-transferase alpha-4 (GSTA4)
Synonyms Glutathione S-transferase A4; Glutathione S-transferase A4-4; GST class-alpha member 4; GSTA4
Gene Name GSTA4
UniProt ID
GSTA4_HUMAN
INTEDE ID
DME0606
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2941
EC Number EC: 2.5.1.18
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.18
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEI
DGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE
VVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPF
LQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Function
This enzyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal, and it conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Fluid shear stress and atherosclerosis (hsa05418 )
Glutathione metabolism (hsa00480 )
Hepatocellular carcinoma (hsa05225 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pathways in cancer (hsa05200 )
Platinum drug resistance (hsa01524 )
Reactome Pathway
Glutathione conjugation (R-HSA-156590 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Cisplatin DMRHGI9 Adenocarcinoma 2D40 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.29E-11 -2.48E-01 -1.19E+00
Alzheimer's disease 8A20 Entorhinal cortex 1.97E-05 -2.24E-01 -1.05E+00
Asthma CA23 Nasal and bronchial airway 9.09E-03 1.48E-01 1.19E-01
Behcet's disease 4A62 Peripheral blood 9.47E-01 8.89E-02 3.67E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.17E-01 6.58E-02 3.75E-01
Bladder cancer 2C94 Bladder tissue 1.51E-16 -1.34E+00 -1.00E+01
Breast cancer 2C60-2C6Z Breast tissue 2.18E-01 -5.02E-02 -9.77E-02
Colon cancer 2B90 Colon tissue 1.47E-01 1.56E-02 4.20E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.43E-01 -2.11E-01 -2.22E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.95E-02 -1.85E-01 -1.22E+00
Gastric cancer 2B72 Gastric tissue 3.28E-02 -1.17E+00 -2.73E+00
Glioblastopma 2A00.00 Nervous tissue 9.73E-02 -3.58E-03 -7.50E-03
Head and neck cancer 2D42 Head and neck tissue 1.80E-17 -7.81E-01 -1.59E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.62E-01 1.31E-01 2.45E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.93E-01 -5.69E-02 -1.10E-01
Interstitial cystitis GC00.3 Bladder tissue 9.24E-02 -6.32E-02 -4.10E-01
Ischemic stroke 8B11 Peripheral blood 7.99E-01 -6.21E-02 -2.43E-01
Liver cancer 2C12.0 Liver tissue 3.30E-17 9.19E-01 1.89E+00
Liver failure DB99.7-DB99.8 Liver tissue 2.62E-01 1.66E-01 2.89E-01
Lung cancer 2C25 Lung tissue 1.11E-01 -4.15E-02 -7.47E-02
Lupus erythematosus 4A40 Whole blood 2.64E-02 -1.01E-01 -2.27E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.32E-01 -1.10E-02 -6.65E-02
Multiple myeloma 2A83.1 Bone marrow 2.40E-03 1.08E-01 7.89E-01
Multiple myeloma 2A83.1 Peripheral blood 6.78E-01 8.78E-02 4.45E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.09E-01 -2.21E-01 -4.19E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.41E-01 -1.76E-01 -3.82E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.45E-02 -2.57E-01 -4.43E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.06E-08 1.26E+00 4.00E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.11E-01 -7.85E-02 -4.13E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.90E-01 2.00E-01 3.31E-01
Olive pollen allergy CA08.00 Peripheral blood 1.56E-02 2.03E-01 1.47E+00
Oral cancer 2B6E Oral tissue 7.54E-03 -4.03E-01 -5.47E-01
Ovarian cancer 2C73 Ovarian tissue 3.18E-03 -1.61E+00 -1.80E+00
Pancreatic cancer 2C10 Pancreas 4.53E-01 -1.09E-01 -1.94E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.00E-01 -2.22E-01 -9.50E-01
Pituitary cancer 2D12 Pituitary tissue 1.07E-02 -6.35E-01 -1.37E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.30E-02 1.08E-01 9.22E-01
Pompe disease 5C51.3 Biceps muscle 9.70E-02 1.25E-01 3.16E-01
Prostate cancer 2C82 Prostate 4.58E-02 -4.91E-01 -8.60E-01
Psoriasis EA90 Skin 2.06E-20 6.66E-01 1.72E+00
Rectal cancer 2B92 Rectal colon tissue 4.78E-01 -8.78E-02 -2.83E-01
Renal cancer 2C90-2C91 Kidney 3.53E-01 -1.08E-01 -1.62E-01
Retinoblastoma 2D02.2 Uvea 3.48E-09 1.84E+00 4.21E+00
Schizophrenia 6A20 Prefrontal cortex 4.70E-02 -2.04E-01 -1.36E-01
Schizophrenia 6A20 Superior temporal cortex 9.89E-01 -7.51E-02 -3.62E-01
Scleroderma 4A42.Z Whole blood 6.39E-01 -1.86E-01 -9.23E-01
Seizure 8A60-8A6Z Whole blood 3.70E-01 -3.42E-02 -1.62E-01
Sepsis with septic shock 1G41 Whole blood 2.51E-21 -2.46E-01 -9.03E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.76E-02 -9.03E-02 -2.87E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.23E-01 -6.45E-02 -2.38E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.24E-01 2.22E-01 6.66E-01
Skin cancer 2C30-2C3Z Skin 3.98E-38 -6.21E-01 -1.21E+00
Thrombocythemia 3B63 Whole blood 6.82E-01 -5.03E-02 -5.06E-01
Thrombocytopenia 3B64 Whole blood 6.06E-01 3.23E-01 5.77E-01
Thyroid cancer 2D10 Thyroid 2.98E-03 -1.13E-01 -2.53E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.37E-01 1.30E-01 3.52E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.01E-01 -2.85E-01 -1.85E+00
Type 2 diabetes 5A11 Liver tissue 5.59E-01 2.00E-01 4.03E-01
Ureter cancer 2C92 Urothelium 5.23E-01 5.10E-02 2.29E-01
Uterine cancer 2C78 Endometrium tissue 2.95E-12 -5.03E-01 -7.46E-01
Vitiligo ED63.0 Skin 3.39E-01 1.17E-01 3.27E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 GSTA4 mediates reduction of cisplatin ototoxicity in female mice. Nat Commun. 2019 Sep 12;10(1):4150.