General Information of Drug-Metabolizing Enzyme (DME) (ID: DEHJU7E)

DME Name Serum paraoxonase/arylesterase 2 (PON2)
Synonyms Aromatic esterase 2; Serum aryldialkylphosphatase 2; A-esterase 2; PON 2; PON2
Gene Name PON2
UniProt ID
PON2_HUMAN
INTEDE ID
DME0620
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5445
EC Number EC: 3.1.1.2
Hydrolases
Ester bond hydrolase
Carboxylic ester hydrolase
EC: 3.1.1.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDIDILPN
GLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNPHGISTFI
DNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDITAVGPAHFYAT
NDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSANGINISPDDKYIYVADIL
AHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIWVGCHPNGQKLFVYDPNNPPS
SEVLRIQNILSEKPTVTTVYANNGSVLQGSSVASVYDGKLLIGTLYHRALYCEL
Function This enzyme can hydrolyze lactones and a number of aromatic carboxylic acid esters.
Reactome Pathway
Synthesis of 5-eicosatetraenoic acids (R-HSA-2142688 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
PARAOXON DMN4ZKC Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.52E-06 3.67E-01 5.55E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.97E-07 2.14E-01 3.02E-01
Asthma CA23 Nasal and bronchial airway 7.71E-01 3.99E-03 6.42E-03
Behcet's disease 4A62 Peripheral blood 2.85E-01 -1.55E-01 -5.15E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.37E-01 2.06E-01 4.53E-01
Bladder cancer 2C94 Bladder tissue 7.64E-02 1.93E-02 8.19E-02
Breast cancer 2C60-2C6Z Breast tissue 4.09E-31 6.79E-01 1.13E+00
Colon cancer 2B90 Colon tissue 3.79E-12 -2.41E-01 -6.55E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.78E-01 -6.35E-02 -1.62E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.51E-01 -7.34E-02 -4.20E-01
Gastric cancer 2B72 Gastric tissue 4.54E-02 1.19E+00 2.95E+00
Glioblastopma 2A00.00 Nervous tissue 7.65E-10 4.70E-01 5.09E-01
Head and neck cancer 2D42 Head and neck tissue 2.31E-01 2.02E-01 2.52E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.40E-01 -3.26E-01 -6.43E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.94E-04 -7.66E-01 -3.24E+00
Interstitial cystitis GC00.3 Bladder tissue 2.10E-01 3.22E-01 1.51E+00
Ischemic stroke 8B11 Peripheral blood 9.36E-01 -1.22E-01 -2.23E-01
Liver cancer 2C12.0 Liver tissue 2.77E-02 4.31E-01 4.40E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.88E-04 -2.06E+00 -3.28E+00
Lung cancer 2C25 Lung tissue 2.67E-07 -2.79E-01 -5.92E-01
Lupus erythematosus 4A40 Whole blood 9.07E-01 2.32E-02 4.34E-02
Major depressive disorder 6A70-6A7Z Hippocampus 2.66E-01 -8.26E-02 -1.81E-01
Multiple myeloma 2A83.1 Bone marrow 1.85E-05 9.49E-01 2.91E+00
Multiple myeloma 2A83.1 Peripheral blood 6.08E-01 -1.40E-01 -2.04E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.87E-01 9.87E-03 3.83E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.76E-01 -7.43E-03 -1.39E-02
Myocardial infarction BA41-BA50 Peripheral blood 4.37E-01 -3.11E-02 -4.48E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.46E-01 -9.08E-02 -1.67E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 7.36E-01 -6.39E-02 -1.05E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.28E-01 -1.18E-02 -6.33E-02
Olive pollen allergy CA08.00 Peripheral blood 4.17E-01 1.33E-01 4.53E-01
Oral cancer 2B6E Oral tissue 1.20E-10 1.61E+00 2.32E+00
Ovarian cancer 2C73 Ovarian tissue 1.30E-07 1.52E+00 5.01E+00
Pancreatic cancer 2C10 Pancreas 1.61E-07 1.67E+00 2.14E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 7.02E-01 1.29E-01 4.19E-01
Pituitary cancer 2D12 Pituitary tissue 1.55E-01 -4.49E-01 -1.20E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.77E-02 2.43E-01 1.15E+00
Pompe disease 5C51.3 Biceps muscle 7.05E-07 8.96E-01 3.26E+00
Prostate cancer 2C82 Prostate 2.65E-04 -1.62E-01 -3.25E-01
Psoriasis EA90 Skin 1.30E-36 7.76E-01 2.40E+00
Rectal cancer 2B92 Rectal colon tissue 5.89E-01 -3.92E-02 -1.09E-01
Renal cancer 2C90-2C91 Kidney 2.07E-03 1.02E+00 1.20E+00
Retinoblastoma 2D02.2 Uvea 8.26E-03 6.00E-01 1.54E+00
Schizophrenia 6A20 Prefrontal cortex 3.24E-01 5.25E-02 4.05E-02
Schizophrenia 6A20 Superior temporal cortex 9.06E-01 2.40E-01 5.15E-01
Scleroderma 4A42.Z Whole blood 3.73E-03 -3.95E-01 -1.92E+00
Seizure 8A60-8A6Z Whole blood 1.39E-01 -3.18E-02 -1.47E-01
Sepsis with septic shock 1G41 Whole blood 3.32E-06 -1.12E-01 -5.92E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.00E-04 2.48E-01 2.46E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 6.40E-01 -1.27E-01 -2.49E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.53E-01 -3.62E-02 -1.58E-01
Skin cancer 2C30-2C3Z Skin 4.76E-02 3.61E-01 8.17E-01
Thrombocythemia 3B63 Whole blood 7.73E-06 2.40E-01 1.95E+00
Thrombocytopenia 3B64 Whole blood 7.57E-01 2.37E-02 4.37E-02
Thyroid cancer 2D10 Thyroid 7.78E-27 8.54E-01 1.58E+00
Tibial muscular dystrophy 8C75 Muscle tissue 7.35E-06 8.15E-01 1.69E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.82E-01 1.72E-01 4.76E-01
Type 2 diabetes 5A11 Liver tissue 9.84E-01 1.62E-01 5.17E-01
Ureter cancer 2C92 Urothelium 6.60E-01 1.18E-02 6.11E-02
Uterine cancer 2C78 Endometrium tissue 7.15E-02 -4.15E-01 -4.73E-01
Vitiligo ED63.0 Skin 3.24E-01 -3.91E-02 -2.33E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Paraoxonases-1, -2 and -3: what are their functions? Chem Biol Interact. 2016 Nov 25;259(Pt B):51-62.