Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEHWR6V)

DME Name Choline/ethanolamine kinase (CHKB)
Synonyms Choline kinase beta; Choline kinase-like protein; Ethanolamine kinase; Ethanolamine kinase beta; Choline/ethanolamine kinase beta; EK; EKB; CHETK; CHKB; CHKL; CKB; CKEKB
Gene Name CHKB
UniProt ID
CHKB_HUMAN
INTEDE ID
DME0467
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1120
EC Number EC: 2.7.1.32
Transferase
Kinase
Phosphotransferase
EC: 2.7.1.32
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGA
WRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES
VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMP
FTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCH
NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARP
TDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQ
ASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS
Function This enzyme has a key role in phospholipid metabolism and catalyzes the first step of phosphatidylethanolamine and phosphatidylcholine biosynthesis.
KEGG Pathway
Choline metabolism in cancer (hsa05231 )
Glycerophospholipid metabolism (hsa00564 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Synthesis of PE (R-HSA-1483213 )
Synthesis of PC (R-HSA-1483191 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
CHOLINE DM5D9YK Insomnia 7A00-7A0Z Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
CHOLINE Insomnia [7A00-7A0Z] Investigative Km = 0.021 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.43E-05 -1.47E-01 -3.58E-01
Alopecia ED70 Skin from scalp 5.45E-02 -1.10E-01 -3.51E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.51E-03 7.77E-02 4.03E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.91E-01 1.34E-01 3.63E-01
Aortic stenosis BB70 Calcified aortic valve 6.97E-01 -2.65E-02 -2.91E-02
Apnea 7A40 Hyperplastic tonsil 2.83E-01 5.90E-01 1.80E+00
Arthropathy FA00-FA5Z Peripheral blood 2.45E-01 1.15E-01 6.44E-01
Asthma CA23 Nasal and bronchial airway 8.74E-04 1.14E-01 1.33E-01
Atopic dermatitis EA80 Skin 5.15E-12 4.91E-01 3.69E+00
Autism 6A02 Whole blood 4.75E-02 1.77E-01 5.14E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.21E-01 -9.06E-02 -6.01E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.74E-03 -9.10E-01 -1.78E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.07E-06 2.25E-01 8.63E-01
Batten disease 5C56.1 Whole blood 2.11E-01 2.70E-01 1.74E+00
Behcet's disease 4A62 Peripheral blood 6.22E-01 -1.41E-01 -3.58E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.09E-01 -1.41E-03 -9.21E-03
Bladder cancer 2C94 Bladder tissue 3.95E-03 -3.44E-01 -1.30E+00
Breast cancer 2C60-2C6Z Breast tissue 7.32E-01 6.54E-02 1.35E-01
Cardioembolic stroke 8B11.20 Whole blood 3.22E-01 -6.95E-02 -3.61E-01
Cervical cancer 2C77 Cervical tissue 7.30E-03 -2.59E-01 -5.19E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.90E-02 -1.42E-01 -3.22E-01
Chronic hepatitis C 1E51.1 Whole blood 3.95E-01 -6.38E-02 -2.19E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.24E-02 -1.29E-01 -4.06E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.28E-01 -8.30E-02 -2.84E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.93E-01 5.02E-03 4.09E-02
Colon cancer 2B90 Colon tissue 3.55E-32 -5.16E-01 -1.28E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.57E-02 9.07E-01 3.04E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.66E-01 2.13E-01 3.13E-01
Endometriosis GA10 Endometrium tissue 9.75E-01 3.17E-02 9.62E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.09E-01 2.33E-02 1.84E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.70E-09 8.08E-01 2.22E+00
Gastric cancer 2B72 Gastric tissue 1.65E-01 -8.51E-01 -1.37E+00
Glioblastopma 2A00.00 Nervous tissue 2.47E-15 -1.80E-01 -6.39E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.56E-01 -2.41E-01 -4.41E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.21E-01 9.45E-01 8.83E-01
Head and neck cancer 2D42 Head and neck tissue 2.09E-26 -6.41E-01 -1.60E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.86E-01 1.53E-02 5.93E-02
Huntington's disease 8A01.10 Whole blood 5.62E-01 -9.59E-02 -3.34E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.96E-02 2.45E-01 1.21E+00
Immunodeficiency 4A00-4A20 Peripheral blood 7.20E-02 -9.17E-02 -6.79E-01
Influenza 1E30 Whole blood 2.11E-02 -6.51E-01 -3.01E+00
Interstitial cystitis GC00.3 Bladder tissue 8.39E-01 -1.05E-01 -4.35E-01
Intracranial aneurysm 8B01.0 Intracranial artery 5.12E-03 4.66E-01 1.17E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.27E-01 -1.34E-01 -2.32E-01
Ischemic stroke 8B11 Peripheral blood 5.01E-01 4.60E-03 1.77E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 2.84E-08 -6.08E-01 -1.33E+00
Lateral sclerosis 8B60.4 Skin 2.02E-01 1.06E-01 1.39E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 3.30E-01 -3.12E-02 -5.94E-02
Liver cancer 2C12.0 Liver tissue 1.04E-03 2.55E-01 6.84E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.07E-05 5.35E-01 2.47E+00
Lung cancer 2C25 Lung tissue 6.61E-02 -5.48E-02 -1.62E-01
Lupus erythematosus 4A40 Whole blood 3.98E-05 4.25E-01 6.60E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.24E-01 7.56E-03 5.43E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.73E-01 -1.30E-01 -2.48E-01
Melanoma 2C30 Skin 2.95E-02 -6.49E-01 -8.78E-01
Multiple myeloma 2A83.1 Peripheral blood 5.57E-01 -1.56E-03 -4.73E-03
Multiple myeloma 2A83.1 Bone marrow 3.39E-01 6.92E-02 2.78E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.83E-02 -2.02E-01 -1.02E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.05E-01 -1.94E-01 -5.52E-01
Myelofibrosis 2A20.2 Whole blood 1.43E-02 -3.63E-01 -2.11E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.00E-01 -1.03E-01 -1.69E-01
Myopathy 8C70.6 Muscle tissue 1.63E-02 2.85E-01 9.89E-01
Neonatal sepsis KA60 Whole blood 7.52E-01 4.25E-03 1.00E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.30E-01 -1.25E-01 -4.86E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.99E-01 1.41E-01 5.04E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.87E-01 8.92E-02 2.00E-01
Olive pollen allergy CA08.00 Peripheral blood 6.23E-04 -8.95E-01 -3.36E+00
Oral cancer 2B6E Oral tissue 3.22E-06 -3.27E-01 -1.21E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.95E-01 3.19E-01 5.24E-01
Osteoporosis FB83.1 Bone marrow 8.64E-01 1.91E-01 7.12E-01
Ovarian cancer 2C73 Ovarian tissue 5.06E-02 -4.67E-01 -9.97E-01
Pancreatic cancer 2C10 Pancreas 3.07E-01 2.68E-01 4.24E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.25E-01 4.24E-02 1.43E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.77E-01 -1.28E-02 -7.29E-02
Pituitary cancer 2D12 Pituitary tissue 4.82E-02 -1.35E-01 -4.84E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.77E-02 7.16E-02 2.48E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.60E-01 -1.33E-02 -1.45E-01
Polycythemia vera 2A20.4 Whole blood 2.05E-10 -2.65E-01 -1.53E+00
Pompe disease 5C51.3 Biceps muscle 6.03E-07 9.39E-01 3.27E+00
Preterm birth KA21.4Z Myometrium 9.94E-01 1.20E-01 2.48E-01
Prostate cancer 2C82 Prostate 1.01E-05 -6.36E-01 -1.35E+00
Psoriasis EA90 Skin 2.61E-11 2.28E-01 8.74E-01
Rectal cancer 2B92 Rectal colon tissue 4.15E-01 1.67E-02 9.57E-02
Renal cancer 2C90-2C91 Kidney 8.30E-01 6.75E-02 2.24E-01
Retinoblastoma 2D02.2 Uvea 1.25E-03 8.76E-01 2.64E+00
Rheumatoid arthritis FA20 Synovial tissue 2.17E-04 8.19E-01 2.29E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.97E-02 -7.05E-02 -4.69E-01
Schizophrenia 6A20 Prefrontal cortex 2.27E-01 9.12E-02 1.65E-01
Schizophrenia 6A20 Superior temporal cortex 7.36E-01 -1.39E-02 -7.96E-02
Scleroderma 4A42.Z Whole blood 1.04E-01 1.52E-01 1.12E+00
Seizure 8A60-8A6Z Whole blood 5.96E-01 1.21E-01 5.76E-01
Sensitive skin EK0Z Skin 7.25E-01 9.17E-03 4.61E-02
Sepsis with septic shock 1G41 Whole blood 2.96E-04 -7.61E-02 -2.06E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.43E-03 -4.94E-01 -1.93E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.75E-01 -2.52E-01 -7.54E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.26E-01 1.56E-01 5.72E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.72E-02 -1.21E-01 -1.69E+00
Skin cancer 2C30-2C3Z Skin 7.44E-09 -2.16E-01 -5.72E-01
Thrombocythemia 3B63 Whole blood 1.18E-03 -2.54E-01 -1.47E+00
Thrombocytopenia 3B64 Whole blood 2.01E-01 4.81E-01 4.62E-01
Thyroid cancer 2D10 Thyroid 5.73E-02 1.66E-02 7.01E-02
Tibial muscular dystrophy 8C75 Muscle tissue 9.15E-04 2.45E-01 8.04E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.51E-02 1.96E-01 1.76E+00
Type 2 diabetes 5A11 Liver tissue 2.50E-02 -5.86E-01 -1.64E+00
Ureter cancer 2C92 Urothelium 8.19E-01 -1.37E-01 -4.76E-01
Uterine cancer 2C78 Endometrium tissue 1.88E-37 -6.67E-01 -1.62E+00
Vitiligo ED63.0 Skin 8.90E-01 2.18E-02 2.27E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Crystal structures of human choline kinase isoforms in complex with hemicholinium-3: single amino acid near the active site influences inhibitor sensitivity. J Biol Chem. 2010 May 21;285(21):16330-40.