Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DEIN8FB)
DME Name | Glycerol/diol dehydratase (dhaB) | ||||
---|---|---|---|---|---|
Synonyms | Glycerol dehydratase; Propanediol dehydratase pduC; dhaB; gldC; pduC | ||||
Gene Name | gldC | ||||
UniProt ID | |||||
INTEDE ID | |||||
EC Number | EC: 4.2.1.30 | ||||
Lineage | Species: Lactobacillus reuteri | ||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
RYAPFNAISILIGAQTGRPGVLTQCSVEEATELQLGMRGFTAYAETISVYGTDRVFTDGD
DTPWSKGFLASCYASRGLKMRFTSGAGSEVLMGYPEGKSMLYLEARCILLTKASGVQGLQ NGAVSCIEIPGAVPNGIREVLGENLLCMMCDIEC |
||||
Function | This enzyme has two forms. One form requires a cobamide coenzyme, while the other is a glycyl radical enzyme. | ||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Investigative Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||