Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEISPU8)

DME Name Arachidonate 12-lipoxygenase (ALOX12B)
Synonyms Arachidonate 12-lipoxygenase 12R-type; Epidermis-type lipoxygenase 12; 12R-LOX; 12R-lipoxygenase; ALOX12B
Gene Name ALOX12B
UniProt ID
LX12B_HUMAN
INTEDE ID
DME0402
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
242
EC Number EC: 1.13.11.31
Oxidoreductase
Oxygen single donor oxidoreductase
Oxygen single donor oxidoreductase
EC: 1.13.11.31
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGRDFATGAVGQYTVQCPQD
LGELIIIRLHKERYAFFPKDPWYCNYVQICAPNGRIYHFPAYQWMDGYETLALREATGKT
TADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRNPNRPEWNGY
IPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIR
KIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDDMVAPFLGE
GTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLHFGPEGKMMPIAIQLSQ
TPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEAFCLALLRNLPMC
HPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLY
LPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEIITYYYPSDAAVEGDPELQSWVQEI
FKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNTGQMEFTAWMPNFPASMR
NPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPLGHFPDIHFVEEAPRR
SIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI
Function
This enzyme catalyzes the regio and stereo-specific incorporation of a single molecule of dioxygen into free and esterified polyunsaturated fatty acids generating lipid hydroperoxides that can be further reduced to the corresponding hydroxy species.
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Metabolic pathways (hsa01100 )
Serotonergic synapse (hsa04726 )
Reactome Pathway
Synthesis of 12-eicosatetraenoic acid derivatives (R-HSA-2142712 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Arachidonic Acid DMUOQZD Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.08E-01 -6.65E-04 -3.29E-03
Alopecia ED70 Skin from scalp 3.77E-03 5.59E-01 6.69E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.29E-05 -1.81E-01 -5.25E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.29E-01 -4.96E-02 -4.26E-01
Aortic stenosis BB70 Calcified aortic valve 8.95E-01 -3.62E-02 -6.38E-02
Apnea 7A40 Hyperplastic tonsil 2.90E-01 -2.57E+00 -1.86E+00
Arthropathy FA00-FA5Z Peripheral blood 7.69E-01 -1.31E-02 -8.98E-02
Asthma CA23 Nasal and bronchial airway 3.94E-03 9.72E-02 3.07E-01
Atopic dermatitis EA80 Skin 1.19E-02 -4.37E-01 -1.03E+00
Autism 6A02 Whole blood 5.76E-01 -1.22E-02 -6.49E-02
Autoimmune uveitis 9A96 Peripheral monocyte 4.97E-02 -1.15E-01 -7.27E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.07E-01 -5.59E-03 -3.90E-02
Bacterial infection of gingival 1C1H Gingival tissue 9.39E-14 -1.02E+00 -1.34E+00
Batten disease 5C56.1 Whole blood 7.21E-01 -2.24E-02 -1.80E-01
Behcet's disease 4A62 Peripheral blood 3.61E-01 -1.58E-01 -5.04E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.20E-01 7.26E-02 3.05E-01
Bladder cancer 2C94 Bladder tissue 5.30E-04 2.80E-01 1.51E+00
Breast cancer 2C60-2C6Z Breast tissue 6.41E-01 1.64E-02 5.22E-02
Cardioembolic stroke 8B11.20 Whole blood 4.77E-01 -9.20E-02 -5.42E-01
Cervical cancer 2C77 Cervical tissue 5.73E-03 -2.79E+00 -1.42E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.52E-01 1.90E-02 7.42E-02
Chronic hepatitis C 1E51.1 Whole blood 8.47E-01 -2.20E-02 -1.54E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.00E-01 3.38E-02 1.85E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.60E-02 9.01E-02 4.62E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.66E-01 -1.21E-02 -8.64E-02
Colon cancer 2B90 Colon tissue 1.06E-03 -7.95E-02 -3.21E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.65E-01 -1.21E-01 -6.11E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.95E-01 1.85E-01 6.10E-01
Endometriosis GA10 Endometrium tissue 1.06E-01 8.56E-02 4.08E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.63E-01 -3.43E-02 -2.51E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.44E-01 -1.60E-01 -6.41E-01
Gastric cancer 2B72 Gastric tissue 1.07E-01 3.30E-01 1.50E+00
Glioblastopma 2A00.00 Nervous tissue 3.77E-72 -5.18E-01 -1.22E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.49E-02 -2.75E-01 -4.89E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.96E-01 -3.54E-02 -2.32E-01
Head and neck cancer 2D42 Head and neck tissue 3.42E-19 1.75E+00 1.59E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.02E-02 -1.37E-01 -5.72E-01
Huntington's disease 8A01.10 Whole blood 2.33E-02 1.92E-01 9.35E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.07E-01 7.33E-03 6.85E-02
Immunodeficiency 4A00-4A20 Peripheral blood 8.13E-01 1.56E-02 1.33E-01
Influenza 1E30 Whole blood 2.53E-01 -3.62E-02 -9.21E-01
Interstitial cystitis GC00.3 Bladder tissue 3.62E-02 1.01E-01 9.47E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.25E-01 9.50E-02 3.97E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.66E-01 1.80E-03 7.26E-03
Ischemic stroke 8B11 Peripheral blood 3.46E-02 1.83E-01 1.60E+00
Juvenile idiopathic arthritis FA24 Peripheral blood 9.73E-01 -3.41E-02 -1.31E-01
Lateral sclerosis 8B60.4 Skin 9.16E-01 1.40E-02 7.73E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 6.46E-01 -4.79E-02 -3.49E-01
Liver cancer 2C12.0 Liver tissue 1.97E-03 -1.03E-01 -4.88E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.24E-02 -2.15E-01 -1.14E+00
Lung cancer 2C25 Lung tissue 1.50E-31 1.78E-01 8.39E-01
Lupus erythematosus 4A40 Whole blood 3.06E-01 -2.42E-02 -6.42E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.42E-01 -1.08E-02 -4.25E-02
Major depressive disorder 6A70-6A7Z Whole blood 8.67E-01 -6.11E-02 -2.81E-01
Melanoma 2C30 Skin 9.74E-02 -9.10E-01 -5.31E-01
Multiple myeloma 2A83.1 Peripheral blood 3.33E-01 -6.10E-03 -3.79E-02
Multiple myeloma 2A83.1 Bone marrow 9.83E-01 -9.62E-02 -4.14E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.80E-01 6.04E-03 1.68E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.16E-02 -2.03E-02 -1.22E-01
Myelofibrosis 2A20.2 Whole blood 3.31E-01 1.38E-01 1.01E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.64E-01 1.41E-01 3.46E-01
Myopathy 8C70.6 Muscle tissue 1.21E-01 -2.08E-01 -8.15E-01
Neonatal sepsis KA60 Whole blood 2.91E-01 -2.56E-02 -9.72E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.44E-02 -3.52E-01 -9.29E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.35E-01 -1.10E-01 -6.64E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.08E-02 9.31E-02 1.39E+00
Olive pollen allergy CA08.00 Peripheral blood 1.96E-01 1.24E-02 1.40E-01
Oral cancer 2B6E Oral tissue 8.45E-01 -2.37E-01 -1.52E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.23E-01 -8.36E-02 -3.14E-01
Osteoporosis FB83.1 Bone marrow 2.88E-01 2.15E-01 1.40E+00
Ovarian cancer 2C73 Ovarian tissue 9.39E-03 5.60E-02 5.15E-01
Pancreatic cancer 2C10 Pancreas 1.09E-02 -2.46E-01 -7.78E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.64E-01 -5.32E-02 -2.62E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.66E-02 6.40E-02 4.37E-01
Pituitary cancer 2D12 Pituitary tissue 2.07E-01 1.74E-01 5.53E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.82E-01 -8.39E-02 -2.14E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.37E-01 3.50E-02 1.69E-01
Polycythemia vera 2A20.4 Whole blood 5.01E-04 8.05E-02 6.24E-01
Pompe disease 5C51.3 Biceps muscle 1.56E-01 -2.42E-02 -1.35E-01
Preterm birth KA21.4Z Myometrium 6.01E-01 -1.36E-01 -4.44E-01
Prostate cancer 2C82 Prostate 8.12E-01 -8.15E-02 -1.81E-01
Psoriasis EA90 Skin 2.04E-42 1.99E+00 2.58E+00
Rectal cancer 2B92 Rectal colon tissue 9.61E-01 1.20E-01 4.66E-01
Renal cancer 2C90-2C91 Kidney 8.84E-01 9.88E-02 2.21E-01
Retinoblastoma 2D02.2 Uvea 1.24E-03 -1.25E-01 -1.05E+00
Rheumatoid arthritis FA20 Synovial tissue 3.68E-01 -3.45E-01 -9.75E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.06E-01 -4.41E-02 -2.32E-01
Schizophrenia 6A20 Prefrontal cortex 3.23E-01 -4.68E-02 -1.22E-01
Schizophrenia 6A20 Superior temporal cortex 4.40E-01 -5.44E-02 -5.81E-01
Scleroderma 4A42.Z Whole blood 4.65E-01 9.53E-02 5.25E-01
Seizure 8A60-8A6Z Whole blood 8.88E-01 -1.56E-01 -6.96E-01
Sensitive skin EK0Z Skin 6.20E-01 2.22E-02 4.54E-02
Sepsis with septic shock 1G41 Whole blood 9.99E-02 -2.72E-02 -9.58E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.71E-01 -1.43E-02 -3.61E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.81E-01 -6.21E-02 -2.55E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.21E-02 8.12E-02 8.75E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.06E-01 5.15E-02 2.76E-01
Skin cancer 2C30-2C3Z Skin 4.93E-74 -3.11E+00 -3.66E+00
Thrombocythemia 3B63 Whole blood 6.15E-02 1.61E-01 1.12E+00
Thrombocytopenia 3B64 Whole blood 2.60E-01 1.09E-01 2.43E-01
Thyroid cancer 2D10 Thyroid 2.65E-01 1.64E-02 7.18E-02
Tibial muscular dystrophy 8C75 Muscle tissue 3.09E-03 -3.34E-01 -1.30E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.08E-03 -6.59E-01 -7.62E+00
Type 2 diabetes 5A11 Liver tissue 1.35E-01 -1.25E-01 -1.05E+00
Ureter cancer 2C92 Urothelium 6.28E-01 8.41E-02 2.67E-01
Uterine cancer 2C78 Endometrium tissue 1.41E-01 3.35E-01 2.72E-01
Vitiligo ED63.0 Skin 5.89E-01 -2.61E-01 -6.29E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Mitochondrial uncoupling reveals a novel therapeutic opportunity for p53-defective cancers. Nat Commun. 2018 Sep 26;9(1):3931.