Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEIW03B)

DME Name NADH-ubiquinone oxidoreductase 20 kDa (NDUFS7)
Synonyms NADH-ubiquinone oxidoreductase 20 kDa subunit; Mitochondrial NADH dehydrogenase [ubiquinone] iron-sulfur protein 7; Complex I-20kD; CI-20kD; NDUFS7; PSST subunit
Gene Name NDUFS7
UniProt ID
NDUS7_HUMAN
INTEDE ID
DME0121
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
374291
EC Number EC: 7.1.1.2
Translocase
Hydron translocase
Hydron translocase
EC: 7.1.1.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRG
EYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVM
IVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYI
PGCPPTAEALLYGILQLQRKIKRERRLQIWYRR
Function
This enzyme is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I).Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
KEGG Pathway
Alzheimer's disease (hsa05010 )
Huntington's disease (hsa05016 )
Metabolic pathways (hsa01100 )
Non-alcoholic fatty liver disease (NAFLD) (hsa04932 )
Oxidative phosphorylation (hsa00190 )
Parkinson's disease (hsa05012 )
Retrograde endocannabinoid signaling (hsa04723 )
Thermogenesis (hsa04714 )
Reactome Pathway
Respiratory electron transport (R-HSA-611105 )
Complex I biogenesis (R-HSA-6799198 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Doxorubicin DMVP5YE Solid tumour/cancer 2A00-2F9Z Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.49E-01 -8.31E-03 -3.02E-02
Alopecia ED70 Skin from scalp 1.26E-01 -4.94E-02 -2.68E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.94E-01 -1.53E-02 -8.09E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 5.08E-01 9.64E-02 4.72E-01
Aortic stenosis BB70 Calcified aortic valve 1.41E-01 1.76E-01 6.38E-01
Apnea 7A40 Hyperplastic tonsil 6.54E-01 3.77E-03 2.46E-02
Arthropathy FA00-FA5Z Peripheral blood 1.73E-01 2.28E-02 1.78E-01
Asthma CA23 Nasal and bronchial airway 1.31E-02 1.12E-01 1.70E-01
Atopic dermatitis EA80 Skin 1.89E-07 3.17E-01 1.43E+00
Autism 6A02 Whole blood 1.46E-02 -1.23E-01 -6.40E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.02E-01 -1.76E-01 -2.59E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.22E-01 2.51E-02 1.45E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.04E-01 3.84E-02 1.41E-01
Batten disease 5C56.1 Whole blood 4.46E-01 4.31E-02 3.66E-01
Behcet's disease 4A62 Peripheral blood 7.36E-01 -6.22E-02 -5.30E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.93E-01 -3.72E-02 -3.38E-01
Bladder cancer 2C94 Bladder tissue 6.52E-03 1.31E-01 1.61E+00
Breast cancer 2C60-2C6Z Breast tissue 3.07E-06 8.25E-02 2.09E-01
Cardioembolic stroke 8B11.20 Whole blood 3.58E-03 -1.95E-01 -9.28E-01
Cervical cancer 2C77 Cervical tissue 1.58E-02 -2.42E-01 -7.74E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.30E-01 4.40E-02 1.99E-01
Chronic hepatitis C 1E51.1 Whole blood 6.40E-01 -3.26E-02 -2.53E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.06E-01 -7.74E-02 -3.22E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.16E-01 4.54E-02 2.24E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.31E-01 7.45E-03 3.06E-02
Colon cancer 2B90 Colon tissue 4.62E-33 -2.88E-01 -1.14E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.69E-02 8.47E-02 7.94E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.56E-01 9.37E-02 2.93E-01
Endometriosis GA10 Endometrium tissue 9.80E-01 7.15E-02 1.59E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.65E-01 -7.37E-02 -5.01E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.63E-06 2.24E-01 1.04E+00
Gastric cancer 2B72 Gastric tissue 4.50E-01 5.20E-01 6.16E-01
Glioblastopma 2A00.00 Nervous tissue 7.18E-32 -2.67E-01 -7.99E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.48E-01 -5.38E-01 -2.77E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.30E-01 1.94E-01 7.11E-01
Head and neck cancer 2D42 Head and neck tissue 1.32E-05 -1.86E-01 -5.90E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.21E-01 1.86E-01 5.49E-01
Huntington's disease 8A01.10 Whole blood 3.48E-01 -6.46E-02 -3.87E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.86E-01 -1.27E-01 -3.77E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.63E-01 5.67E-02 4.96E-01
Influenza 1E30 Whole blood 6.43E-01 2.12E-01 6.55E-01
Interstitial cystitis GC00.3 Bladder tissue 3.55E-02 1.43E-01 1.54E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.48E-01 5.32E-02 3.10E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.06E-01 -6.80E-02 -2.23E-01
Ischemic stroke 8B11 Peripheral blood 1.74E-01 -7.88E-02 -6.18E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.72E-09 -2.91E-01 -9.31E-01
Lateral sclerosis 8B60.4 Skin 2.92E-02 2.84E-01 2.36E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 9.80E-01 9.74E-03 2.28E-02
Liver cancer 2C12.0 Liver tissue 8.25E-02 -1.73E-01 -4.66E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.65E-02 3.52E-01 9.10E-01
Lung cancer 2C25 Lung tissue 1.85E-11 1.32E-01 5.64E-01
Lupus erythematosus 4A40 Whole blood 9.59E-01 -1.66E-04 -5.89E-04
Major depressive disorder 6A70-6A7Z Hippocampus 3.47E-01 -2.58E-02 -2.36E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.95E-01 -1.63E-02 -5.53E-02
Melanoma 2C30 Skin 5.08E-01 1.10E-01 1.64E-01
Multiple myeloma 2A83.1 Peripheral blood 1.73E-01 -1.65E-01 -6.24E-01
Multiple myeloma 2A83.1 Bone marrow 3.30E-06 1.05E+00 4.53E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.74E-01 -4.89E-02 -2.74E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.63E-01 -1.11E-02 -4.29E-02
Myelofibrosis 2A20.2 Whole blood 1.92E-02 9.36E-02 7.95E-01
Myocardial infarction BA41-BA50 Peripheral blood 6.00E-01 -7.25E-02 -1.95E-01
Myopathy 8C70.6 Muscle tissue 2.00E-03 -2.64E-01 -1.77E+00
Neonatal sepsis KA60 Whole blood 1.98E-03 -4.70E-02 -2.01E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.09E-03 2.73E-01 1.05E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.60E-01 -1.15E-01 -3.07E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.87E-01 -6.04E-02 -5.47E-01
Olive pollen allergy CA08.00 Peripheral blood 4.45E-01 1.89E-01 3.67E-01
Oral cancer 2B6E Oral tissue 1.01E-04 -4.29E-01 -9.26E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.96E-01 -8.29E-02 -1.26E-01
Osteoporosis FB83.1 Bone marrow 1.82E-01 1.61E-01 9.26E-01
Ovarian cancer 2C73 Ovarian tissue 2.71E-02 3.38E-01 1.04E+00
Pancreatic cancer 2C10 Pancreas 8.30E-01 3.85E-02 7.86E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 8.84E-01 7.28E-02 3.92E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.32E-02 9.34E-02 1.13E+00
Pituitary cancer 2D12 Pituitary tissue 9.66E-04 3.50E-01 1.36E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.52E-03 2.94E-01 1.64E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.63E-01 -2.53E-02 -1.78E-01
Polycythemia vera 2A20.4 Whole blood 1.59E-03 -1.09E-01 -9.19E-01
Pompe disease 5C51.3 Biceps muscle 1.78E-05 -7.36E-01 -4.56E+00
Preterm birth KA21.4Z Myometrium 2.66E-02 -2.76E-01 -2.13E+00
Prostate cancer 2C82 Prostate 1.27E-01 -1.10E-01 -2.18E-01
Psoriasis EA90 Skin 3.00E-04 -2.53E-01 -5.52E-01
Rectal cancer 2B92 Rectal colon tissue 5.65E-04 -4.05E-01 -2.60E+00
Renal cancer 2C90-2C91 Kidney 7.72E-01 -9.30E-03 -4.74E-02
Retinoblastoma 2D02.2 Uvea 2.60E-04 2.85E-01 1.43E+00
Rheumatoid arthritis FA20 Synovial tissue 8.07E-01 8.53E-02 1.29E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.26E-01 1.53E-02 1.33E-01
Schizophrenia 6A20 Prefrontal cortex 4.76E-01 -4.11E-02 -1.68E-01
Schizophrenia 6A20 Superior temporal cortex 2.59E-02 -9.71E-02 -6.10E-01
Scleroderma 4A42.Z Whole blood 3.92E-09 3.94E-01 5.11E+00
Seizure 8A60-8A6Z Whole blood 8.88E-01 -2.72E-02 -1.38E-01
Sensitive skin EK0Z Skin 8.09E-01 -2.36E-02 -1.52E-01
Sepsis with septic shock 1G41 Whole blood 8.70E-01 3.73E-02 1.72E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.45E-01 -3.23E-02 -2.58E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.89E-02 2.33E-01 1.26E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 5.78E-02 7.75E-02 3.17E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.79E-01 -2.30E-01 -7.87E-01
Skin cancer 2C30-2C3Z Skin 8.65E-05 -1.78E-01 -3.59E-01
Thrombocythemia 3B63 Whole blood 5.83E-03 -6.84E-02 -5.88E-01
Thrombocytopenia 3B64 Whole blood 7.28E-01 7.43E-02 8.85E-02
Thyroid cancer 2D10 Thyroid 2.61E-01 -5.29E-02 -2.43E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.04E-04 -3.63E-01 -1.22E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.43E-02 -2.65E-01 -6.86E+00
Type 2 diabetes 5A11 Liver tissue 2.18E-01 -2.03E-01 -1.05E+00
Ureter cancer 2C92 Urothelium 7.39E-01 -4.84E-02 -1.92E-01
Uterine cancer 2C78 Endometrium tissue 8.04E-07 -2.20E-01 -4.05E-01
Vitiligo ED63.0 Skin 1.43E-01 -1.11E-01 -6.35E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Differential ability of cytostatics from anthraquinone group to generate free radicals in three enzymatic systems: NADH dehydrogenase, NADPH cytochrome P450 reductase, and xanthine oxidase. Oncol Res. 2003;13(5):245-52.