Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEIX1PO)

DME Name Phosphorylethanolamine transferase (PCYT2)
Synonyms CTP:phosphoethanolamine cytidylyltransferase; Ethanolamine-phosphate cytidylyltransferase; PCYT2
Gene Name PCYT2
UniProt ID
PCY2_HUMAN
INTEDE ID
DME0152
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5833
EC Number EC: 2.7.7.14
Transferase
Kinase
Nucleotidyltransferase
EC: 2.7.7.14
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDE
EIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTV
DGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKC
PGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLA
ERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHF
KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARN
QKKEAKELAFLEAARQQAAQPLGERDGDF
Function This enzyme plays an important role in the biosynthesis of the phospholipid phosphatidylethanolamine. It catalyzes the formation of CDP- ethanolamine.
KEGG Pathway
Glycerophospholipid metabolism (hsa00564 )
Metabolic pathways (hsa01100 )
Phosphonate and phosphinate metabolism (hsa00440 )
Reactome Pathway
Synthesis of PE (R-HSA-1483213 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Lamivudine DMI347A Chronic HBV infection 1E51.0Z Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.09E-08 1.86E-01 6.85E-01
Alopecia ED70 Skin from scalp 8.03E-02 1.43E-01 4.68E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.89E-02 -4.95E-02 -3.24E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.64E-01 -1.07E-02 -5.78E-02
Aortic stenosis BB70 Calcified aortic valve 6.71E-01 2.54E-01 6.59E-01
Apnea 7A40 Hyperplastic tonsil 3.43E-01 -4.32E-02 -3.85E-01
Arthropathy FA00-FA5Z Peripheral blood 7.45E-01 1.66E-02 1.90E-01
Asthma CA23 Nasal and bronchial airway 1.22E-01 1.07E-01 2.08E-01
Atopic dermatitis EA80 Skin 1.43E-06 3.34E-01 1.36E+00
Autism 6A02 Whole blood 4.28E-01 2.58E-02 1.37E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.64E-02 -2.34E-01 -1.56E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.52E-01 -8.55E-02 -5.03E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.55E-06 2.54E-01 9.30E-01
Batten disease 5C56.1 Whole blood 2.78E-01 4.52E-02 6.03E-01
Behcet's disease 4A62 Peripheral blood 4.51E-01 -7.33E-02 -3.78E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.81E-01 -8.60E-03 -5.91E-02
Bladder cancer 2C94 Bladder tissue 1.81E-01 1.81E-01 6.36E-01
Breast cancer 2C60-2C6Z Breast tissue 3.07E-02 6.06E-02 1.71E-01
Cardioembolic stroke 8B11.20 Whole blood 8.21E-01 -1.13E-02 -5.36E-02
Cervical cancer 2C77 Cervical tissue 2.79E-02 -2.08E-01 -7.25E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.40E-01 7.69E-02 4.97E-01
Chronic hepatitis C 1E51.1 Whole blood 4.65E-01 -1.10E-02 -1.11E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.91E-01 -1.58E-01 -5.86E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.89E-04 2.12E-01 5.76E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.70E-01 -7.25E-02 -2.24E-01
Colon cancer 2B90 Colon tissue 1.11E-02 -9.94E-02 -3.71E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.88E-01 6.54E-02 1.45E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.35E-01 7.84E-02 2.62E-01
Endometriosis GA10 Endometrium tissue 7.58E-01 1.33E-02 2.54E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.19E-02 1.53E-01 1.60E+00
Familial hypercholesterolemia 5C80.00 Whole blood 2.21E-01 4.89E-02 2.50E-01
Gastric cancer 2B72 Gastric tissue 6.96E-01 -2.24E-01 -7.78E-01
Glioblastopma 2A00.00 Nervous tissue 6.66E-162 -7.92E-01 -2.39E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.06E-01 -3.51E-01 -6.80E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.00E-02 -2.06E-01 -8.04E-01
Head and neck cancer 2D42 Head and neck tissue 9.12E-18 -5.45E-01 -1.17E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.43E-01 -5.75E-03 -2.70E-02
Huntington's disease 8A01.10 Whole blood 5.85E-01 1.36E-03 6.86E-03
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.21E-02 -2.78E-01 -1.69E+00
Immunodeficiency 4A00-4A20 Peripheral blood 6.83E-01 -4.77E-03 -4.07E-02
Influenza 1E30 Whole blood 1.06E-02 3.13E-01 2.79E+00
Interstitial cystitis GC00.3 Bladder tissue 5.15E-02 -1.96E-01 -7.67E-01
Intracranial aneurysm 8B01.0 Intracranial artery 7.07E-01 9.88E-03 2.57E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.81E-02 -5.78E-02 -2.78E-01
Ischemic stroke 8B11 Peripheral blood 6.68E-01 -2.27E-02 -1.71E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.79E-03 -9.25E-02 -3.03E-01
Lateral sclerosis 8B60.4 Skin 7.17E-02 1.31E-01 8.74E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.65E-01 7.62E-02 4.09E-01
Liver cancer 2C12.0 Liver tissue 9.51E-01 -4.53E-02 -8.87E-02
Liver failure DB99.7-DB99.8 Liver tissue 1.46E-03 -6.37E-01 -2.15E+00
Lung cancer 2C25 Lung tissue 1.28E-01 -2.87E-02 -1.19E-01
Lupus erythematosus 4A40 Whole blood 3.22E-01 -2.91E-02 -7.16E-02
Major depressive disorder 6A70-6A7Z Hippocampus 7.99E-01 -2.79E-02 -1.94E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.94E-01 4.59E-02 2.89E-01
Melanoma 2C30 Skin 1.20E-01 -1.81E-01 -3.54E-01
Multiple myeloma 2A83.1 Peripheral blood 2.65E-01 -1.56E-01 -8.72E-01
Multiple myeloma 2A83.1 Bone marrow 1.44E-03 2.71E-01 1.59E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.42E-01 7.78E-02 2.54E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.01E-02 -1.03E-01 -6.83E-01
Myelofibrosis 2A20.2 Whole blood 4.69E-01 1.23E-02 1.16E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.40E-01 -2.07E-02 -8.39E-02
Myopathy 8C70.6 Muscle tissue 9.31E-04 -2.24E-01 -1.67E+00
Neonatal sepsis KA60 Whole blood 4.40E-01 -9.38E-02 -3.26E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.60E-07 -8.73E-01 -3.72E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.83E-01 -2.63E-01 -6.80E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.61E-01 9.27E-02 2.23E+00
Olive pollen allergy CA08.00 Peripheral blood 1.24E-01 3.35E-01 1.47E+00
Oral cancer 2B6E Oral tissue 2.93E-08 -5.69E-01 -1.64E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.68E-01 4.25E-02 1.30E-01
Osteoporosis FB83.1 Bone marrow 5.40E-01 9.15E-02 8.04E-01
Ovarian cancer 2C73 Ovarian tissue 6.65E-01 4.17E-03 1.06E-02
Pancreatic cancer 2C10 Pancreas 5.19E-01 -4.48E-02 -1.69E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.85E-01 2.55E-03 9.47E-03
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.44E-02 -7.81E-02 -5.88E-01
Pituitary cancer 2D12 Pituitary tissue 5.96E-03 2.59E-01 1.21E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.75E-01 2.03E-01 8.83E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.87E-01 -4.68E-02 -2.10E-01
Polycythemia vera 2A20.4 Whole blood 3.10E-01 9.35E-02 8.37E-01
Pompe disease 5C51.3 Biceps muscle 2.15E-01 -9.07E-02 -3.88E-01
Preterm birth KA21.4Z Myometrium 5.34E-02 3.21E-01 1.25E+00
Prostate cancer 2C82 Prostate 5.14E-01 -2.41E-01 -3.88E-01
Psoriasis EA90 Skin 8.68E-04 -1.51E-01 -4.51E-01
Rectal cancer 2B92 Rectal colon tissue 6.56E-02 -1.13E-01 -9.29E-01
Renal cancer 2C90-2C91 Kidney 3.12E-05 -8.28E-01 -2.21E+00
Retinoblastoma 2D02.2 Uvea 8.43E-02 1.24E-01 6.68E-01
Rheumatoid arthritis FA20 Synovial tissue 9.57E-02 -5.07E-01 -1.25E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.18E-01 -3.98E-02 -2.45E-01
Schizophrenia 6A20 Prefrontal cortex 6.41E-02 -1.07E-01 -4.52E-01
Schizophrenia 6A20 Superior temporal cortex 5.27E-01 -4.54E-02 -3.56E-01
Scleroderma 4A42.Z Whole blood 1.30E-02 -5.18E-02 -7.31E-01
Seizure 8A60-8A6Z Whole blood 7.58E-01 -7.39E-02 -3.36E-01
Sensitive skin EK0Z Skin 5.02E-01 5.61E-02 3.01E-01
Sepsis with septic shock 1G41 Whole blood 1.98E-03 -7.68E-02 -2.85E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.53E-01 -5.75E-02 -4.38E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.24E-01 2.12E-01 7.23E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.79E-01 3.11E-01 5.49E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.91E-01 -9.13E-02 -5.62E-01
Skin cancer 2C30-2C3Z Skin 3.03E-03 9.01E-02 2.33E-01
Thrombocythemia 3B63 Whole blood 3.18E-01 -2.48E-02 -2.28E-01
Thrombocytopenia 3B64 Whole blood 6.52E-01 4.42E-01 4.74E-01
Thyroid cancer 2D10 Thyroid 7.37E-01 1.04E-02 4.38E-02
Tibial muscular dystrophy 8C75 Muscle tissue 1.34E-05 -5.63E-01 -1.88E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.20E-01 -1.18E-01 -5.07E-01
Type 2 diabetes 5A11 Liver tissue 2.95E-01 -1.39E-01 -3.54E-01
Ureter cancer 2C92 Urothelium 7.18E-01 1.94E-02 9.74E-02
Uterine cancer 2C78 Endometrium tissue 1.60E-03 -6.66E-02 -1.38E-01
Vitiligo ED63.0 Skin 3.78E-01 -1.78E-01 -6.72E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Model for intracellular Lamivudine metabolism in peripheral blood mononuclear cells ex vivo and in human immunodeficiency virus type 1-infected adolescents. Antimicrob Agents Chemother. 2006 Aug;50(8):2686-94.