Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEIZLTN)

DME Name Docosahexaenoic acid omega-hydroxylase (CYP4F11)
Synonyms Phylloquinone omega-hydroxylase CYP4F11; Cytochrome P450 4F11; Long-chain fatty acid omega-monooxygenase; 3-hydroxy fatty acids omega-hydroxylase CYP4F11; CYP4F11; CYPIVF11
Gene Name CYP4F11
UniProt ID
CP4FB_HUMAN
INTEDE ID
DME0616
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
57834
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWF
WGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPK
DMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQR
LASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQQIL
LHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFID
VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQE
LLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVC
LINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKV
VLALTLLHFRILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ
Function This enzyme involves in the metabolism of various endogenous substrates, including fatty acids and their oxygenated derivatives.
Reactome Pathway
Fatty acids (R-HSA-211935 )
Miscellaneous substrates (R-HSA-211958 )
Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691 )
Eicosanoids (R-HSA-211979 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
4 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Benzphetamine DMIJATC Obesity 5B81 Approved [1]
Chlorpromazine DMBGZI3 Acute intermittent hepatic porphyria 5C58.11 Approved [1]
Erythromycin DM4K7GQ Acne vulgaris ED80 Approved [1]
Imipramine DM2NUH3 Depression 6A70-6A7Z Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ethylmorphine DM0YROF Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.01E-01 -1.06E-02 -6.71E-02
Alzheimer's disease 8A20 Entorhinal cortex 9.32E-03 1.82E-01 4.37E-01
Asthma CA23 Nasal and bronchial airway 4.82E-01 -3.54E-02 -2.90E-02
Behcet's disease 4A62 Peripheral blood 6.18E-01 -4.50E-02 -2.33E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.05E-01 -1.36E-03 -7.35E-03
Bladder cancer 2C94 Bladder tissue 1.27E-01 -1.34E+00 -1.44E+00
Breast cancer 2C60-2C6Z Breast tissue 1.19E-17 8.80E-02 3.12E-01
Colon cancer 2B90 Colon tissue 2.02E-02 -2.69E-01 -3.24E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.95E-01 6.79E-03 2.41E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.28E-02 1.27E-01 9.82E-01
Gastric cancer 2B72 Gastric tissue 5.05E-01 -8.65E-01 -7.52E-01
Glioblastopma 2A00.00 Nervous tissue 3.01E-03 -1.21E-01 -2.98E-01
Head and neck cancer 2D42 Head and neck tissue 9.44E-07 -1.16E+00 -9.17E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.37E-02 1.07E-01 5.52E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.69E-01 2.32E-02 1.91E-01
Interstitial cystitis GC00.3 Bladder tissue 9.17E-04 -2.18E+00 -3.71E+00
Ischemic stroke 8B11 Peripheral blood 6.25E-01 -4.07E-02 -2.43E-01
Liver cancer 2C12.0 Liver tissue 1.40E-06 -1.19E+00 -1.13E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.63E-02 -1.10E+00 -1.39E+00
Lung cancer 2C25 Lung tissue 3.16E-41 7.34E-02 2.81E-01
Lupus erythematosus 4A40 Whole blood 1.57E-01 -2.03E-02 -7.29E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.86E-01 -4.38E-02 -2.46E-01
Multiple myeloma 2A83.1 Bone marrow 6.33E-02 -2.78E-01 -6.20E-01
Multiple myeloma 2A83.1 Peripheral blood 2.08E-01 7.99E-02 5.87E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.02E-01 1.12E-01 8.28E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.28E-01 8.73E-03 7.91E-02
Myocardial infarction BA41-BA50 Peripheral blood 8.59E-01 -1.66E-02 -4.70E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.06E-04 -4.87E-01 -2.08E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.27E-01 -1.16E-01 -1.97E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.15E-01 6.87E-02 7.75E-01
Olive pollen allergy CA08.00 Peripheral blood 8.19E-02 1.32E-01 7.00E-01
Oral cancer 2B6E Oral tissue 6.29E-04 9.39E-02 1.74E-01
Ovarian cancer 2C73 Ovarian tissue 8.71E-04 6.43E-01 1.43E+00
Pancreatic cancer 2C10 Pancreas 3.85E-01 -3.04E-01 -4.51E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.30E-02 -1.98E-01 -1.31E+00
Pituitary cancer 2D12 Pituitary tissue 6.94E-01 -1.02E-01 -5.32E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.64E-01 -2.04E-03 -1.07E-02
Pompe disease 5C51.3 Biceps muscle 1.02E-01 1.36E-01 1.08E+00
Prostate cancer 2C82 Prostate 1.04E-02 9.58E-01 9.69E-01
Psoriasis EA90 Skin 8.76E-18 3.14E-01 8.85E-01
Rectal cancer 2B92 Rectal colon tissue 5.14E-01 2.94E-01 3.88E-01
Renal cancer 2C90-2C91 Kidney 8.68E-01 -5.47E-02 -8.66E-02
Retinoblastoma 2D02.2 Uvea 7.30E-01 -8.86E-02 -5.05E-01
Schizophrenia 6A20 Prefrontal cortex 8.22E-01 3.93E-02 1.31E-01
Schizophrenia 6A20 Superior temporal cortex 9.82E-01 6.23E-02 2.83E-01
Scleroderma 4A42.Z Whole blood 8.71E-04 2.13E-01 1.64E+00
Seizure 8A60-8A6Z Whole blood 2.38E-01 -4.01E-02 -2.47E-01
Sepsis with septic shock 1G41 Whole blood 1.12E-01 -3.09E-02 -1.13E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.71E-01 -4.43E-02 -4.40E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.46E-01 1.95E-01 1.91E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.18E-01 1.32E-02 1.38E-01
Skin cancer 2C30-2C3Z Skin 1.87E-03 -4.88E-02 -1.05E-01
Thrombocythemia 3B63 Whole blood 1.09E-02 1.29E-01 8.55E-01
Thrombocytopenia 3B64 Whole blood 8.78E-01 3.93E-02 1.55E-01
Thyroid cancer 2D10 Thyroid 9.25E-01 -8.49E-02 -1.42E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.23E-02 -1.22E-01 -9.14E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.00E-02 3.49E-01 1.28E+00
Type 2 diabetes 5A11 Liver tissue 3.28E-01 -6.65E-03 -8.26E-03
Ureter cancer 2C92 Urothelium 7.63E-01 1.13E-02 7.81E-02
Uterine cancer 2C78 Endometrium tissue 7.25E-02 5.24E-02 8.44E-02
Vitiligo ED63.0 Skin 4.30E-01 -3.37E-02 -6.53E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Expression and characterization of human cytochrome P450 4F11: putative role in the metabolism of therapeutic drugs and eicosanoids. Toxicol Appl Pharmacol. 2004 Sep 15;199(3):295-304.