Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEJ73Q9)

DME Name Dimethylaniline oxidase 1 (FMO1)
Synonyms Dimethylaniline monooxygenase [N-oxide-forming] 1; FMO 1; FMO1; Fetal hepatic flavin-containing monooxygenase 1
Gene Name FMO1
UniProt ID
FMO1_HUMAN
INTEDE ID
DME0059
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2326
EC Number EC: 1.14.13.8
Oxidoreductase
Oxygen paired donor oxidoreductase
NADH/NADPH donor oxidoreductase
EC: 1.14.13.8
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSA
VSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPD
IFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQ
NMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIR
PSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAH
LQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWF
GLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGK
WEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL
Function This enzyme is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides and form I catalyzes the N-oxygenation of secondary and tertiary amines.
KEGG Pathway
Drug metabolism - cytochrome P450 (hsa00982 )
Reactome Pathway
FMO oxidises nucleophiles (R-HSA-217271 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Olopatadine DMKMWQG Allergic conjunctivitis 9A60.02 Approved []
Dapoxetine DMV6KFY Premature ejaculation HA03.0Z Phase 4 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.89E-01 -4.31E-02 -2.18E-01
Alopecia ED70 Skin from scalp 1.36E-01 2.25E-01 3.82E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.10E-02 -4.35E-02 -1.89E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.67E-01 1.51E-01 8.76E-01
Aortic stenosis BB70 Calcified aortic valve 3.10E-01 1.14E-01 1.20E-01
Apnea 7A40 Hyperplastic tonsil 1.02E-01 1.46E+00 1.07E+00
Arthropathy FA00-FA5Z Peripheral blood 6.00E-01 -1.44E-02 -9.01E-02
Asthma CA23 Nasal and bronchial airway 8.93E-01 -7.60E-02 -1.09E-01
Atopic dermatitis EA80 Skin 9.17E-01 -5.61E-02 -1.60E-01
Autism 6A02 Whole blood 4.47E-01 -1.75E-02 -6.69E-02
Autoimmune uveitis 9A96 Peripheral monocyte 1.75E-01 -8.54E-02 -3.24E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.88E-01 9.39E-03 5.98E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.43E-10 8.52E-01 1.19E+00
Batten disease 5C56.1 Whole blood 3.48E-01 2.98E-01 2.54E+00
Behcet's disease 4A62 Peripheral blood 7.70E-01 -1.64E-02 -1.50E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.78E-01 -3.35E-02 -1.84E-01
Bladder cancer 2C94 Bladder tissue 1.14E-04 1.05E+00 2.25E+00
Breast cancer 2C60-2C6Z Breast tissue 1.20E-43 -1.22E+00 -1.12E+00
Cardioembolic stroke 8B11.20 Whole blood 4.74E-01 -5.06E-02 -2.31E-01
Cervical cancer 2C77 Cervical tissue 5.37E-02 4.11E-01 5.05E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.16E-02 1.04E-01 6.07E-01
Chronic hepatitis C 1E51.1 Whole blood 4.23E-01 5.72E-02 2.65E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.66E-01 -2.71E-01 -3.23E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.75E-02 -8.84E-02 -3.04E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.43E-03 -9.23E-01 -1.11E+00
Colon cancer 2B90 Colon tissue 8.45E-05 1.82E-01 2.59E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.31E-01 -9.76E-02 -3.14E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.19E-01 3.98E-02 3.01E-01
Endometriosis GA10 Endometrium tissue 9.74E-03 8.27E-02 1.64E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.42E-01 1.05E-01 5.08E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.91E-02 -1.85E-01 -7.78E-01
Gastric cancer 2B72 Gastric tissue 8.41E-10 3.53E-01 6.41E+00
Glioblastopma 2A00.00 Nervous tissue 9.96E-18 1.49E-01 2.46E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.44E-01 7.72E-02 5.46E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.61E-04 -4.70E-01 -2.21E+00
Head and neck cancer 2D42 Head and neck tissue 1.59E-02 8.45E-01 4.66E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.45E-01 -7.95E-02 -2.61E-01
Huntington's disease 8A01.10 Whole blood 5.82E-01 0.00E+00 0.00E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.05E-04 1.08E+00 2.40E+00
Immunodeficiency 4A00-4A20 Peripheral blood 8.84E-01 3.21E-02 2.72E-01
Influenza 1E30 Whole blood 3.58E-01 3.81E-02 1.90E-01
Interstitial cystitis GC00.3 Bladder tissue 5.10E-04 1.26E+00 4.79E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.72E-01 -8.72E-01 -9.81E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.44E-01 -1.81E-02 -6.24E-02
Ischemic stroke 8B11 Peripheral blood 6.59E-02 1.61E-01 7.16E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.08E-01 -9.70E-02 -2.35E-01
Lateral sclerosis 8B60.4 Skin 1.19E-01 1.82E-01 1.71E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 7.69E-01 1.40E-02 5.26E-02
Liver cancer 2C12.0 Liver tissue 6.00E-02 -7.76E-02 -1.02E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.29E-01 5.68E-01 8.92E-01
Lung cancer 2C25 Lung tissue 3.17E-21 7.72E-01 8.95E-01
Lupus erythematosus 4A40 Whole blood 3.78E-01 -3.88E-03 -1.05E-02
Major depressive disorder 6A70-6A7Z Hippocampus 9.33E-02 6.69E-02 4.37E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.79E-02 1.40E-02 6.93E-02
Melanoma 2C30 Skin 6.85E-01 -1.68E-01 -1.17E-01
Multiple myeloma 2A83.1 Peripheral blood 1.62E-01 1.65E-01 1.34E+00
Multiple myeloma 2A83.1 Bone marrow 1.91E-04 -6.62E-01 -2.34E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.46E-01 -1.45E-01 -5.59E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.77E-03 1.12E-01 4.42E-01
Myelofibrosis 2A20.2 Whole blood 5.11E-02 1.83E-01 1.06E+00
Myocardial infarction BA41-BA50 Peripheral blood 5.58E-01 8.79E-02 1.43E-01
Myopathy 8C70.6 Muscle tissue 9.10E-04 3.79E-01 1.13E+00
Neonatal sepsis KA60 Whole blood 3.49E-03 -1.53E-01 -4.89E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.65E-03 -1.85E-01 -1.01E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.13E-03 5.22E-01 2.51E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.28E-01 1.08E-03 1.09E-03
Olive pollen allergy CA08.00 Peripheral blood 1.74E-01 5.47E-02 1.59E+00
Oral cancer 2B6E Oral tissue 5.32E-01 2.67E-02 2.28E-02
Osteoarthritis FA00-FA0Z Synovial tissue 4.17E-01 6.86E-02 9.23E-02
Osteoporosis FB83.1 Bone marrow 1.21E-01 1.62E-01 6.89E-01
Ovarian cancer 2C73 Ovarian tissue 6.66E-03 -1.14E+00 -1.46E+00
Pancreatic cancer 2C10 Pancreas 4.80E-01 4.27E-01 4.07E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.97E-01 -1.77E-02 -7.19E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.44E-04 -2.49E-01 -1.31E+00
Pituitary cancer 2D12 Pituitary tissue 8.96E-05 -9.18E-01 -1.72E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.75E-03 -9.53E-01 -1.56E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.04E-01 -4.19E-02 -2.80E-01
Polycythemia vera 2A20.4 Whole blood 2.64E-05 1.80E-01 9.29E-01
Pompe disease 5C51.3 Biceps muscle 1.37E-06 1.73E+00 4.27E+00
Preterm birth KA21.4Z Myometrium 6.27E-01 -1.44E-01 -3.20E-01
Prostate cancer 2C82 Prostate 7.08E-02 -2.16E-01 -2.82E-01
Psoriasis EA90 Skin 2.56E-09 6.04E-01 9.96E-01
Rectal cancer 2B92 Rectal colon tissue 1.11E-02 -3.99E-02 -4.17E-01
Renal cancer 2C90-2C91 Kidney 2.76E-03 -1.50E+00 -1.01E+00
Retinoblastoma 2D02.2 Uvea 5.48E-02 1.55E-01 1.25E+00
Rheumatoid arthritis FA20 Synovial tissue 3.00E-02 8.47E-01 8.08E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.15E-01 -8.55E-03 -4.82E-02
Schizophrenia 6A20 Prefrontal cortex 3.39E-01 8.45E-03 2.42E-02
Schizophrenia 6A20 Superior temporal cortex 4.47E-01 -6.32E-02 -3.49E-01
Scleroderma 4A42.Z Whole blood 5.23E-01 -1.35E-02 -4.76E-02
Seizure 8A60-8A6Z Whole blood 1.76E-01 -1.54E-01 -5.36E-01
Sensitive skin EK0Z Skin 3.01E-02 -4.40E-01 -3.19E+00
Sepsis with septic shock 1G41 Whole blood 1.12E-04 -1.40E-01 -4.33E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.58E-01 -7.54E-02 -1.63E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.27E-01 -1.40E-01 -9.19E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.54E-01 -7.89E-03 -4.79E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.38E-01 1.46E-01 2.67E-01
Skin cancer 2C30-2C3Z Skin 1.60E-17 -8.69E-01 -1.14E+00
Thrombocythemia 3B63 Whole blood 2.32E-02 1.15E-01 6.61E-01
Thrombocytopenia 3B64 Whole blood 1.66E-01 3.50E-01 1.24E+00
Thyroid cancer 2D10 Thyroid 2.16E-08 -8.00E-01 -1.40E+00
Tibial muscular dystrophy 8C75 Muscle tissue 2.14E-16 3.41E+00 8.17E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.13E-01 5.66E-02 1.97E+00
Type 2 diabetes 5A11 Liver tissue 8.04E-01 -7.27E-02 -7.70E-02
Ureter cancer 2C92 Urothelium 2.88E-01 1.06E-01 4.23E-01
Uterine cancer 2C78 Endometrium tissue 5.62E-02 2.60E-02 3.04E-02
Vitiligo ED63.0 Skin 1.18E-01 -7.39E-01 -1.07E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Pharmacokinetics of single and multiple escalating doses of dapoxetine in healthy volunteers. Clinical Pharmacology Therapeutics, 2004, 75(2):P32.