Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEJFMQ8)

DME Name Phosphomannomutase 1 (PMM1)
Synonyms Alpha-D-phosphohexomutase 1; Alpha-phosphomannomutase 1; IMP-sensitive glucose-1,6-bisphosphatase 1; Phosphoglucomutase/phosphomannomutase 1; PMM 1; PMM1
Gene Name PMM1
UniProt ID
PMM1_HUMAN
INTEDE ID
DME0453
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5372
EC Number EC: 5.4.2.8
Isomerase
Mutase
Phosphomutase
EC: 5.4.2.8
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIA
EQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLR
LPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLR
FSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSV
VSPQDTVQRCREIFFPETAHEA
Function This enzyme is responsible for the degradation of glucose-1,6-bisphosphate in ischemic brain.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Fructose and mannose metabolism (hsa00051 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Synthesis of GDP-mannose (R-HSA-446205 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-glucose 1-phosphate DMPW46G N. A. N. A. Investigative [1]
D-Mannose 1-Phosphate DM7O1IW Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
D-Mannose 1-Phosphate Discovery agent [N.A.] Investigative Km = 0.016 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.29E-45 -6.87E-01 -2.19E+00
Alopecia ED70 Skin from scalp 2.02E-01 -4.63E-02 -1.05E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.95E-09 -2.33E-01 -7.23E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.09E-01 2.16E-02 1.02E-01
Aortic stenosis BB70 Calcified aortic valve 7.85E-01 1.93E-01 2.16E-01
Apnea 7A40 Hyperplastic tonsil 4.92E-01 6.30E-01 1.89E+00
Arthropathy FA00-FA5Z Peripheral blood 3.51E-01 -1.53E-01 -8.83E-01
Asthma CA23 Nasal and bronchial airway 8.81E-01 3.54E-02 5.42E-02
Atopic dermatitis EA80 Skin 9.69E-04 2.72E-01 1.03E+00
Autism 6A02 Whole blood 2.67E-01 8.68E-02 2.79E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.41E-01 6.02E-02 3.26E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.87E-02 2.68E-01 6.60E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.03E-06 -2.05E-01 -6.89E-01
Batten disease 5C56.1 Whole blood 2.14E-01 2.81E-01 1.95E+00
Behcet's disease 4A62 Peripheral blood 8.51E-02 -1.84E-01 -1.01E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.45E-01 -1.55E-02 -5.79E-02
Bladder cancer 2C94 Bladder tissue 3.55E-04 -7.91E-01 -2.67E+00
Breast cancer 2C60-2C6Z Breast tissue 2.94E-02 -1.55E-01 -2.25E-01
Cardioembolic stroke 8B11.20 Whole blood 6.20E-10 -3.84E-01 -2.24E+00
Cervical cancer 2C77 Cervical tissue 1.21E-01 -1.22E-01 -2.27E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.43E-02 -1.49E-01 -4.79E-01
Chronic hepatitis C 1E51.1 Whole blood 1.58E-01 -1.23E-01 -5.65E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.62E-02 -1.77E-01 -4.39E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.28E-01 2.52E-02 6.00E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.89E-03 -4.55E-01 -1.13E+00
Colon cancer 2B90 Colon tissue 1.44E-44 -7.03E-01 -1.67E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.79E-02 5.76E-01 2.11E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.03E-01 -3.20E-01 -7.40E-01
Endometriosis GA10 Endometrium tissue 6.08E-02 -2.32E-01 -5.54E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.22E-01 2.52E-02 1.67E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.35E-06 6.32E-01 1.64E+00
Gastric cancer 2B72 Gastric tissue 4.02E-01 -4.77E-01 -1.10E+00
Glioblastopma 2A00.00 Nervous tissue 2.74E-56 -4.68E-01 -1.20E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.73E-01 6.77E-03 2.99E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.13E-02 3.88E-01 8.40E-01
Head and neck cancer 2D42 Head and neck tissue 3.59E-29 -1.17E+00 -2.01E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.86E-01 -2.33E-01 -5.73E-01
Huntington's disease 8A01.10 Whole blood 2.25E-01 -3.79E-02 -2.20E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.37E-01 -7.45E-01 -1.13E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.14E-02 -3.73E-02 -3.40E-01
Influenza 1E30 Whole blood 8.78E-03 3.38E-01 2.57E+00
Interstitial cystitis GC00.3 Bladder tissue 2.66E-02 -3.59E-01 -1.69E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.00E-01 -3.27E-02 -1.31E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.29E-03 -2.51E-01 -5.10E-01
Ischemic stroke 8B11 Peripheral blood 7.87E-01 4.19E-02 2.66E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.67E-04 -6.06E-02 -3.13E-01
Lateral sclerosis 8B60.4 Skin 2.63E-01 4.43E-02 2.84E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.63E-01 5.16E-01 7.63E-01
Liver cancer 2C12.0 Liver tissue 2.39E-01 -2.34E-02 -4.52E-02
Liver failure DB99.7-DB99.8 Liver tissue 5.21E-03 -9.88E-01 -1.64E+00
Lung cancer 2C25 Lung tissue 3.06E-31 -6.12E-01 -1.47E+00
Lupus erythematosus 4A40 Whole blood 7.03E-02 3.05E-01 3.26E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.83E-01 1.94E-02 8.58E-02
Major depressive disorder 6A70-6A7Z Whole blood 9.26E-01 -4.92E-02 -9.53E-02
Melanoma 2C30 Skin 1.14E-02 -6.55E-01 -1.05E+00
Multiple myeloma 2A83.1 Peripheral blood 8.53E-01 -1.69E-01 -2.99E-01
Multiple myeloma 2A83.1 Bone marrow 1.83E-06 1.08E+00 4.72E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.30E-01 1.44E-01 1.12E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.13E-01 3.35E-02 1.03E-01
Myelofibrosis 2A20.2 Whole blood 5.08E-01 4.35E-03 3.41E-02
Myocardial infarction BA41-BA50 Peripheral blood 2.25E-01 -7.51E-01 -7.67E-01
Myopathy 8C70.6 Muscle tissue 8.13E-03 2.39E-01 1.22E+00
Neonatal sepsis KA60 Whole blood 2.69E-02 1.22E-01 2.66E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.80E-02 -9.98E-02 -4.75E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.90E-02 -6.83E-01 -1.25E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.27E-01 -4.00E-02 -1.19E-01
Olive pollen allergy CA08.00 Peripheral blood 7.28E-01 -4.95E-02 -1.88E-01
Oral cancer 2B6E Oral tissue 2.18E-03 -2.50E-01 -4.04E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.86E-01 3.03E-01 2.48E-01
Osteoporosis FB83.1 Bone marrow 2.17E-02 2.79E-01 1.41E+00
Ovarian cancer 2C73 Ovarian tissue 4.14E-06 -1.23E+00 -3.89E+00
Pancreatic cancer 2C10 Pancreas 8.64E-01 -1.88E-02 -4.52E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 9.80E-01 8.10E-02 2.39E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.87E-01 -1.16E-01 -5.88E-01
Pituitary cancer 2D12 Pituitary tissue 2.02E-01 -3.74E-01 -1.26E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.18E-03 -6.96E-01 -2.01E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.96E-01 -2.92E-02 -2.06E-01
Polycythemia vera 2A20.4 Whole blood 4.61E-12 -2.09E-01 -1.62E+00
Pompe disease 5C51.3 Biceps muscle 6.21E-01 1.36E-01 6.54E-01
Preterm birth KA21.4Z Myometrium 3.32E-01 -2.32E-01 -8.27E-01
Prostate cancer 2C82 Prostate 3.07E-03 2.59E-01 8.91E-01
Psoriasis EA90 Skin 2.62E-04 -1.54E-01 -5.12E-01
Rectal cancer 2B92 Rectal colon tissue 1.51E-06 -8.45E-01 -4.65E+00
Renal cancer 2C90-2C91 Kidney 7.79E-02 -3.43E-01 -9.99E-01
Retinoblastoma 2D02.2 Uvea 8.37E-03 2.94E-01 2.11E+00
Rheumatoid arthritis FA20 Synovial tissue 5.32E-05 6.12E-01 2.43E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.26E-02 -2.16E-02 -1.18E-01
Schizophrenia 6A20 Prefrontal cortex 9.18E-03 -2.46E-01 -5.14E-01
Schizophrenia 6A20 Superior temporal cortex 9.90E-01 2.19E-02 9.52E-02
Scleroderma 4A42.Z Whole blood 4.92E-02 -7.63E-02 -5.37E-01
Seizure 8A60-8A6Z Whole blood 2.25E-01 3.92E-01 1.59E+00
Sensitive skin EK0Z Skin 4.34E-01 -1.41E-01 -7.82E-01
Sepsis with septic shock 1G41 Whole blood 3.52E-07 1.47E-01 3.62E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.24E-03 -5.55E-01 -5.03E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.35E-01 -2.54E-01 -8.17E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.48E-01 -5.35E-03 -1.57E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.36E-01 -3.05E-01 -1.24E+00
Skin cancer 2C30-2C3Z Skin 9.01E-03 9.38E-02 2.43E-01
Thrombocythemia 3B63 Whole blood 4.94E-03 -1.05E-01 -8.46E-01
Thrombocytopenia 3B64 Whole blood 3.28E-01 5.54E-01 4.20E-01
Thyroid cancer 2D10 Thyroid 6.40E-01 -4.88E-02 -2.27E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.41E-04 4.62E-01 1.51E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.16E-02 -7.25E-01 -7.65E+00
Type 2 diabetes 5A11 Liver tissue 1.94E-01 -7.54E-01 -9.71E-01
Ureter cancer 2C92 Urothelium 5.64E-01 1.78E-01 4.97E-01
Uterine cancer 2C78 Endometrium tissue 1.11E-32 -1.24E+00 -1.55E+00
Vitiligo ED63.0 Skin 9.61E-06 5.37E-01 3.88E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The X-ray crystal structures of human alpha-phosphomannomutase 1 reveal the structural basis of congenital disorder of glycosylation type 1a. J Biol Chem. 2006 May 26;281(21):14918-26.