Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEKRS6L)

DME Name Xylosylprotein 4-beta-galactosyltransferase (XGalT-1)
Synonyms
UDP-galactose:beta-xylose beta-1,4-galactosyltransferase; Beta-1,4-galactosyltransferase 7; Proteoglycan UDP-galactose:beta-xylose beta1,4-galactosyltransferase I; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 7; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 7; Xylosylprotein beta-1,4-galactosyltransferase; b4Gal-T7; B4GALT7; Beta-1,4-GalTase 7; Beta4Gal-T7; UNQ748/PRO1478; XGALT1; XGPT; XGalT-1
Gene Name B4GALT7
UniProt ID
B4GT7_HUMAN
INTEDE ID
DME0551
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
11285
EC Number EC: 2.4.1.133
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.133
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MFPSRRKAAQLPWEDGRSGLLSGGLPRKCSVFHLFVACLSLGFFSLLWLQLSCSGDVARA
VRGQGQETSGPPRACPPEPPPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLS
RKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEA
GPFHVASPELHPLYHYKTYVGGILLLSKQHYRLCNGMSNRFWGWGREDDEFYRRIKGAGL
QLFRPSGITTGYKTFRHLHDPAWRKRDQKRIAAQKQEQFKVDREGGLNTVKYHVASRTAL
SVGGAPCTVLNIMLDCDKTATPWCTFS
Function This enzyme is required for the biosynthesis of the tetrasaccharide linkage region of proteoglycans, especially for small proteoglycans in skin fibroblasts.
KEGG Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate (hsa00532 )
Glycosaminoglycan biosynthesis - heparan sulfate / heparin (hsa00534 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Defective B4GALT7 causes EDS, progeroid type (R-HSA-3560783 )
A tetrasaccharide linker sequence is required for GAG synthesis (R-HSA-1971475 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Uridine Diphosphate Galactose DMPA0BJ Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Uridine Diphosphate Galactose Discovery agent [N.A.] Investigative Km = 0.22 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.99E-21 2.96E-01 1.14E+00
Alopecia ED70 Skin from scalp 3.60E-01 -1.63E-01 -4.11E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.59E-06 -1.31E-01 -8.51E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.55E-01 9.52E-02 6.35E-01
Aortic stenosis BB70 Calcified aortic valve 5.02E-01 6.25E-03 2.43E-02
Apnea 7A40 Hyperplastic tonsil 7.75E-01 -1.66E-02 -1.12E-01
Arthropathy FA00-FA5Z Peripheral blood 1.75E-01 -1.09E-01 -6.49E-01
Asthma CA23 Nasal and bronchial airway 5.41E-05 1.92E-02 5.28E-02
Atopic dermatitis EA80 Skin 4.16E-04 2.96E-01 1.03E+00
Autism 6A02 Whole blood 3.13E-01 3.93E-02 2.04E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.93E-01 -2.52E-01 -1.92E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.08E-01 -2.28E-02 -1.91E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.96E-10 3.23E-01 9.89E-01
Batten disease 5C56.1 Whole blood 3.98E-01 6.97E-02 5.62E-01
Behcet's disease 4A62 Peripheral blood 1.42E-01 -9.42E-02 -8.30E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.72E-01 -4.71E-02 -3.92E-01
Bladder cancer 2C94 Bladder tissue 3.86E-01 7.87E-02 3.96E-01
Breast cancer 2C60-2C6Z Breast tissue 2.75E-16 2.10E-01 5.99E-01
Cardioembolic stroke 8B11.20 Whole blood 2.56E-01 -3.93E-02 -1.68E-01
Cervical cancer 2C77 Cervical tissue 7.36E-01 -1.43E-01 -4.62E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.68E-01 4.00E-02 1.79E-01
Chronic hepatitis C 1E51.1 Whole blood 5.47E-01 -6.38E-02 -4.20E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.47E-02 -2.98E-01 -9.01E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.93E-03 1.99E-01 6.83E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.69E-01 -1.12E-01 -7.09E-01
Colon cancer 2B90 Colon tissue 3.17E-43 3.31E-01 1.50E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.19E-01 3.20E-02 2.12E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.03E-01 -2.03E-01 -4.47E-01
Endometriosis GA10 Endometrium tissue 6.23E-01 1.25E-01 3.06E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.80E-01 4.72E-02 3.48E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.92E-04 2.38E-01 1.10E+00
Gastric cancer 2B72 Gastric tissue 3.24E-02 4.78E-01 2.92E+00
Glioblastopma 2A00.00 Nervous tissue 2.23E-04 3.40E-02 1.36E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.99E-01 -1.43E-01 -3.59E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.71E-01 1.81E-01 8.69E-01
Head and neck cancer 2D42 Head and neck tissue 8.08E-01 -1.04E-02 -3.92E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.01E-01 1.72E-01 7.81E-01
Huntington's disease 8A01.10 Whole blood 3.41E-01 -2.32E-02 -1.17E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.16E-02 3.55E-01 1.97E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.76E-01 -1.01E-01 -7.27E-01
Influenza 1E30 Whole blood 1.96E-05 -4.81E-01 -2.34E+01
Interstitial cystitis GC00.3 Bladder tissue 4.92E-01 -1.13E-02 -6.54E-02
Intracranial aneurysm 8B01.0 Intracranial artery 4.74E-05 3.48E-01 1.11E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.69E-01 -7.83E-02 -2.69E-01
Ischemic stroke 8B11 Peripheral blood 6.18E-01 -2.10E-02 -1.49E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.93E-06 -2.36E-01 -5.65E-01
Lateral sclerosis 8B60.4 Skin 7.88E-01 -4.90E-02 -1.89E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.77E-01 2.86E-02 1.39E-01
Liver cancer 2C12.0 Liver tissue 2.88E-08 2.42E-01 8.62E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.73E-01 -3.94E-02 -7.98E-02
Lung cancer 2C25 Lung tissue 1.26E-45 3.41E-01 1.44E+00
Lupus erythematosus 4A40 Whole blood 7.71E-01 7.32E-02 1.48E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.27E-01 -3.97E-02 -3.92E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.80E-01 -4.22E-02 -1.46E-01
Melanoma 2C30 Skin 6.50E-01 -6.54E-04 -1.17E-03
Multiple myeloma 2A83.1 Peripheral blood 8.99E-01 -1.51E-01 -1.05E+00
Multiple myeloma 2A83.1 Bone marrow 8.42E-04 4.15E-01 2.04E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.72E-01 -3.64E-02 -1.83E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.07E-01 1.43E-01 5.12E-01
Myelofibrosis 2A20.2 Whole blood 9.41E-02 3.00E-02 2.89E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.26E-01 -5.72E-02 -1.62E-01
Myopathy 8C70.6 Muscle tissue 1.06E-02 -1.47E-01 -2.33E+00
Neonatal sepsis KA60 Whole blood 2.42E-04 -2.51E-01 -1.04E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.77E-06 5.00E-01 2.43E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.01E-01 -1.17E-01 -3.96E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.01E-02 2.64E-01 1.31E+00
Olive pollen allergy CA08.00 Peripheral blood 8.82E-01 -1.15E-01 -2.89E-01
Oral cancer 2B6E Oral tissue 4.06E-05 -2.94E-01 -1.17E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.63E-01 1.70E-01 3.43E-01
Osteoporosis FB83.1 Bone marrow 7.79E-01 8.36E-02 3.34E-01
Ovarian cancer 2C73 Ovarian tissue 2.44E-02 1.27E-01 8.63E-01
Pancreatic cancer 2C10 Pancreas 3.61E-02 1.35E-01 4.82E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.24E-02 -9.17E-02 -4.08E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.66E-03 -1.35E-01 -9.97E-01
Pituitary cancer 2D12 Pituitary tissue 8.82E-04 2.54E-01 1.33E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.56E-02 1.60E-01 7.68E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.00E-01 -1.17E-01 -3.90E-01
Polycythemia vera 2A20.4 Whole blood 2.57E-02 -4.20E-02 -3.54E-01
Pompe disease 5C51.3 Biceps muscle 1.34E-04 7.78E-01 4.54E+00
Preterm birth KA21.4Z Myometrium 4.08E-01 -4.33E-01 -1.37E+00
Prostate cancer 2C82 Prostate 4.60E-02 -2.99E-03 -6.35E-03
Psoriasis EA90 Skin 1.49E-10 1.90E-01 7.21E-01
Rectal cancer 2B92 Rectal colon tissue 1.42E-06 1.58E-01 3.27E+00
Renal cancer 2C90-2C91 Kidney 9.78E-03 5.69E-02 2.89E-01
Retinoblastoma 2D02.2 Uvea 5.40E-06 5.04E-01 2.72E+00
Rheumatoid arthritis FA20 Synovial tissue 9.01E-02 7.90E-02 3.44E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.71E-01 -1.75E-02 -2.00E-01
Schizophrenia 6A20 Prefrontal cortex 7.66E-01 -3.24E-03 -1.64E-02
Schizophrenia 6A20 Superior temporal cortex 2.83E-01 -4.65E-02 -5.18E-01
Scleroderma 4A42.Z Whole blood 3.39E-01 3.70E-02 3.72E-01
Seizure 8A60-8A6Z Whole blood 1.07E-01 1.66E-01 1.16E+00
Sensitive skin EK0Z Skin 3.67E-01 -5.46E-03 -4.64E-02
Sepsis with septic shock 1G41 Whole blood 7.41E-20 -2.66E-01 -1.13E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.50E-04 -3.28E-01 -3.05E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.02E-01 -5.89E-03 -3.44E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 2.89E-01 4.07E-01 1.15E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.44E-01 -3.27E-01 -1.58E+00
Skin cancer 2C30-2C3Z Skin 5.98E-35 4.87E-01 1.57E+00
Thrombocythemia 3B63 Whole blood 7.80E-01 4.39E-03 3.45E-02
Thrombocytopenia 3B64 Whole blood 3.90E-01 5.33E-01 4.47E-01
Thyroid cancer 2D10 Thyroid 6.63E-03 -5.60E-02 -2.11E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.01E-02 -1.19E-01 -5.15E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.07E-02 -9.00E-02 -1.07E+00
Type 2 diabetes 5A11 Liver tissue 4.61E-01 -1.25E-01 -5.61E-01
Ureter cancer 2C92 Urothelium 7.42E-01 -1.07E-02 -4.31E-02
Uterine cancer 2C78 Endometrium tissue 3.61E-06 -4.40E-02 -7.51E-02
Vitiligo ED63.0 Skin 7.68E-01 2.80E-02 2.03E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Probing the acceptor active site organization of the human recombinant beta1,4-galactosyltransferase 7 and design of xyloside-based inhibitors. J Biol Chem. 2015 Mar 20;290(12):7658-70.