Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEKX5CD)

DME Name NADH-ubiquinone oxidoreductase 49 kDa (NDUFS2)
Synonyms NADH-ubiquinone oxidoreductase 49 kDa subunit; Mitochondrial NADH dehydrogenase [ubiquinone] iron-sulfur protein 2; Complex I-49kD; CI-49kD; NDUFS2
Gene Name NDUFS2
UniProt ID
NDUS2_HUMAN
INTEDE ID
DME0119
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4720
EC Number EC: 7.1.1.2
Translocase
Hydron translocase
Hydron translocase
EC: 7.1.1.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAALRALCGFRGVAAQVLRPGAGVRLPIQPSRGVRQWQPDVEWAQQFGGAVMYPSKETAH
WKPPPWNDVDPPKDTIVKNITLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGT
EKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRL
LNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGL
MDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQW
DLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDD
AKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPY
RCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR
Function
This enzyme is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I).Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
KEGG Pathway
Alzheimer's disease (hsa05010 )
Huntington's disease (hsa05016 )
Metabolic pathways (hsa01100 )
Non-alcoholic fatty liver disease (NAFLD) (hsa04932 )
Oxidative phosphorylation (hsa00190 )
Parkinson's disease (hsa05012 )
Retrograde endocannabinoid signaling (hsa04723 )
Thermogenesis (hsa04714 )
Reactome Pathway
Respiratory electron transport (R-HSA-611105 )
Complex I biogenesis (R-HSA-6799198 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Doxorubicin DMVP5YE Acute myelogenous leukaemia 2A41 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.21E-01 3.74E-02 1.27E-01
Alopecia ED70 Skin from scalp 8.32E-01 6.42E-02 2.47E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.15E-06 -2.34E-01 -7.29E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.09E-01 1.03E-01 6.02E-01
Aortic stenosis BB70 Calcified aortic valve 8.29E-01 -9.74E-02 -1.85E-01
Apnea 7A40 Hyperplastic tonsil 4.29E-01 4.26E-01 9.95E-01
Arthropathy FA00-FA5Z Peripheral blood 1.52E-01 -2.11E-02 -1.83E-01
Asthma CA23 Nasal and bronchial airway 5.05E-01 4.52E-02 8.02E-02
Atopic dermatitis EA80 Skin 7.49E-01 3.80E-02 3.29E-01
Autism 6A02 Whole blood 1.78E-02 -1.50E-01 -4.85E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.87E-01 -3.76E-03 -1.77E-02
Autosomal dominant monocytopenia 4B04 Whole blood 8.31E-01 -8.13E-02 -2.06E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.24E-01 -5.61E-02 -2.56E-01
Batten disease 5C56.1 Whole blood 3.04E-01 -4.03E-01 -1.68E+00
Behcet's disease 4A62 Peripheral blood 8.86E-01 6.39E-02 3.45E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.21E-01 -2.06E-02 -8.62E-02
Bladder cancer 2C94 Bladder tissue 2.94E-01 1.10E-03 7.85E-03
Breast cancer 2C60-2C6Z Breast tissue 1.27E-74 5.21E-01 1.65E+00
Cardioembolic stroke 8B11.20 Whole blood 8.15E-01 -1.26E-02 -7.93E-02
Cervical cancer 2C77 Cervical tissue 3.88E-01 -1.19E-01 -3.65E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.36E-01 -2.58E-02 -7.78E-02
Chronic hepatitis C 1E51.1 Whole blood 6.67E-01 -6.49E-02 -2.68E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.94E-01 -3.83E-02 -1.40E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.23E-01 8.45E-03 3.73E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.72E-01 -2.21E-01 -7.83E-01
Colon cancer 2B90 Colon tissue 3.79E-64 -4.99E-01 -2.07E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.30E-01 2.50E-02 3.81E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.21E-01 -1.85E-01 -1.40E+00
Endometriosis GA10 Endometrium tissue 3.58E-01 9.19E-02 2.27E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.30E-01 6.95E-02 4.83E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.55E-13 9.93E-01 1.84E+00
Gastric cancer 2B72 Gastric tissue 3.85E-01 1.36E-01 4.21E-01
Glioblastopma 2A00.00 Nervous tissue 1.53E-37 -3.19E-01 -8.66E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.29E-01 5.13E-02 1.86E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.94E-03 1.17E+00 1.70E+00
Head and neck cancer 2D42 Head and neck tissue 1.63E-02 -6.27E-02 -2.45E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.29E-01 1.08E-01 3.25E-01
Huntington's disease 8A01.10 Whole blood 6.39E-01 -5.75E-02 -1.62E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.02E-01 -1.66E-01 -4.95E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.51E-01 1.06E-02 8.12E-02
Influenza 1E30 Whole blood 2.42E-05 -9.06E-01 -1.04E+01
Interstitial cystitis GC00.3 Bladder tissue 1.09E-01 -6.94E-02 -6.67E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.24E-01 2.27E-02 6.48E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.62E-01 -4.92E-01 -8.44E-01
Ischemic stroke 8B11 Peripheral blood 6.09E-02 -2.41E-01 -9.37E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.60E-16 -7.14E-01 -1.50E+00
Lateral sclerosis 8B60.4 Skin 3.55E-02 2.16E-01 2.43E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 2.22E-01 2.13E-02 1.98E-02
Liver cancer 2C12.0 Liver tissue 3.87E-01 -4.73E-02 -1.54E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.37E-02 -5.60E-01 -2.89E+00
Lung cancer 2C25 Lung tissue 2.36E-55 3.50E-01 1.72E+00
Lupus erythematosus 4A40 Whole blood 8.85E-03 2.75E-01 4.19E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.69E-01 3.89E-02 2.03E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.30E-01 -7.41E-02 -1.27E-01
Melanoma 2C30 Skin 8.48E-01 3.14E-02 7.72E-02
Multiple myeloma 2A83.1 Peripheral blood 7.30E-01 -2.82E-02 -5.40E-02
Multiple myeloma 2A83.1 Bone marrow 2.24E-06 8.32E-01 4.15E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.49E-01 -1.12E-01 -5.20E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.85E-01 1.00E-01 3.27E-01
Myelofibrosis 2A20.2 Whole blood 1.03E-01 -2.66E-01 -1.64E+00
Myocardial infarction BA41-BA50 Peripheral blood 5.60E-02 -7.95E-02 -1.68E-01
Myopathy 8C70.6 Muscle tissue 3.40E-01 -7.27E-02 -2.95E-01
Neonatal sepsis KA60 Whole blood 2.17E-14 4.50E-01 1.39E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 8.17E-04 4.63E-01 1.61E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.77E-01 1.21E-01 3.35E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.12E-01 6.69E-02 5.31E-01
Olive pollen allergy CA08.00 Peripheral blood 3.78E-01 2.23E-01 7.09E-01
Oral cancer 2B6E Oral tissue 2.99E-01 -2.12E-02 -3.77E-02
Osteoarthritis FA00-FA0Z Synovial tissue 5.34E-01 -2.35E-01 -2.70E-01
Osteoporosis FB83.1 Bone marrow 7.43E-03 -3.59E-01 -4.24E+00
Ovarian cancer 2C73 Ovarian tissue 3.75E-01 1.87E-01 6.47E-01
Pancreatic cancer 2C10 Pancreas 1.34E-05 3.52E-01 1.52E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.36E-01 2.76E-02 6.88E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.14E-01 -4.38E-02 -5.02E-01
Pituitary cancer 2D12 Pituitary tissue 3.68E-05 4.48E-01 1.77E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.04E-04 3.90E-01 2.13E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.63E-01 -2.67E-02 -1.25E-01
Polycythemia vera 2A20.4 Whole blood 2.45E-08 -2.20E-01 -1.32E+00
Pompe disease 5C51.3 Biceps muscle 2.93E-01 -6.84E-02 -4.97E-01
Preterm birth KA21.4Z Myometrium 2.59E-01 -7.74E-02 -2.82E-01
Prostate cancer 2C82 Prostate 4.42E-01 -9.13E-02 -2.35E-01
Psoriasis EA90 Skin 1.13E-01 7.32E-02 3.91E-01
Rectal cancer 2B92 Rectal colon tissue 2.00E-04 -4.64E-01 -3.32E+00
Renal cancer 2C90-2C91 Kidney 2.65E-04 -4.34E-01 -1.41E+00
Retinoblastoma 2D02.2 Uvea 1.67E-02 3.49E-01 1.23E+00
Rheumatoid arthritis FA20 Synovial tissue 6.84E-01 3.13E-02 2.87E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.23E-01 -9.74E-04 -7.68E-03
Schizophrenia 6A20 Prefrontal cortex 5.43E-04 -1.56E-01 -5.90E-01
Schizophrenia 6A20 Superior temporal cortex 2.70E-01 -1.28E-01 -4.40E-01
Scleroderma 4A42.Z Whole blood 7.14E-02 1.29E-01 1.06E+00
Seizure 8A60-8A6Z Whole blood 3.59E-01 -2.31E-01 -6.32E-01
Sensitive skin EK0Z Skin 4.14E-01 3.88E-02 3.32E-01
Sepsis with septic shock 1G41 Whole blood 4.06E-30 2.62E-01 1.49E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.12E-01 -1.82E-01 -1.48E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.52E-03 -1.52E-01 -3.77E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.05E-01 -5.61E-02 -9.89E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.40E-01 1.58E-01 8.13E-01
Skin cancer 2C30-2C3Z Skin 9.49E-12 2.42E-01 9.48E-01
Thrombocythemia 3B63 Whole blood 5.07E-04 -2.32E-01 -1.42E+00
Thrombocytopenia 3B64 Whole blood 3.81E-01 1.16E-01 9.50E-02
Thyroid cancer 2D10 Thyroid 7.15E-01 -1.03E-01 -5.33E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.50E-02 -3.18E-01 -1.56E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.59E-03 -4.73E-01 -3.22E+00
Type 2 diabetes 5A11 Liver tissue 6.56E-01 2.35E-02 6.11E-02
Ureter cancer 2C92 Urothelium 6.59E-01 -3.19E-02 -1.02E-01
Uterine cancer 2C78 Endometrium tissue 5.81E-01 2.44E-02 5.98E-02
Vitiligo ED63.0 Skin 6.75E-08 2.70E-01 4.35E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Differential ability of cytostatics from anthraquinone group to generate free radicals in three enzymatic systems: NADH dehydrogenase, NADPH cytochrome P450 reductase, and xanthine oxidase. Oncol Res. 2003;13(5):245-52.