Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEL87ZT)

DME Name Choline/ethanolaminephosphotransferase 1 (CEPT1)
Synonyms Aminoalcohol phosphotransferase 1; Choline/ethanolamine phosphotransferase 1; CEPT1; PRO1101; hCEPT1
Gene Name CEPT1
UniProt ID
CEPT1_HUMAN
INTEDE ID
DME0103
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
10390
EC Number EC: 2.7.8.1
Transferase
Kinase
Phosphotransferase
EC: 2.7.8.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSGHRSTRKRCGDSHPESPVGFGHMSTTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAG
RSLLEPLMQGYWEWLVRRVPSWIAPNLITIIGLSINICTTILLVFYCPTATEQAPLWAYI
ACACGLFIYQSLDAIDGKQARRTNSSSPLGELFDHGCDSLSTVFVVLGTCIAVQLGTNPD
WMFFCCFAGTFMFYCAHWQTYVSGTLRFGIIDVTEVQIFIIIMHLLAVIGGPPFWQSMIP
VLNIQMKIFPALCTVAGTIFSCTNYFRVIFTGGVGKNGSTIAGTSVLSPFLHIGSVITLA
AMIYKKSAVQLFEKHPCLYILTFGFVSAKITNKLVVAHMTKSEMHLHDTAFIGPALLFLD
QYFNSFIDEYIVLWIALVFSFFDLIRYCVSVCNQIASHLHIHVFRIKVSTAHSNHH
Function
This enzyme catalyzes both phosphatidylcholine and phosphatidylethanolamine biosynthesis from CDP-choline and CDP- ethanolamine, respectively. It is involved in protein-dependent process of phospholipid transport to distribute phosphatidyl choline to the lumenal surface. It has a higher cholinephosphotransferase activity than ethanolaminephosphotransferase activity.
KEGG Pathway
Ether lipid metabolism (hsa00565 )
Glycerophospholipid metabolism (hsa00564 )
Metabolic pathways (hsa01100 )
Phosphonate and phosphinate metabolism (hsa00440 )
Reactome Pathway
Synthesis of PE (R-HSA-1483213 )
Synthesis of PC (R-HSA-1483191 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Choline salicylate DM8P137 Inflammation 1A00-CA43.1 Approved [1]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
CHOLINE DM5D9YK Insomnia 7A00-7A0Z Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.66E-03 -7.03E-02 -1.42E-01
Alopecia ED70 Skin from scalp 8.13E-01 -1.35E-01 -3.10E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.11E-03 1.33E-01 6.14E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.85E-01 -6.55E-01 -6.20E-01
Aortic stenosis BB70 Calcified aortic valve 5.48E-01 1.29E-01 4.28E-01
Apnea 7A40 Hyperplastic tonsil 2.05E-01 4.05E-01 2.33E+00
Arthropathy FA00-FA5Z Peripheral blood 3.63E-01 -6.18E-02 -2.69E-01
Asthma CA23 Nasal and bronchial airway 3.51E-01 -1.05E-02 -2.08E-02
Atopic dermatitis EA80 Skin 1.74E-08 7.01E-01 2.03E+00
Autism 6A02 Whole blood 7.32E-01 -9.97E-02 -1.38E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.69E-02 2.63E-01 1.59E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.82E-02 2.44E-01 1.28E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.20E-05 -3.92E-01 -7.79E-01
Batten disease 5C56.1 Whole blood 9.61E-01 -6.50E-02 -2.41E-01
Behcet's disease 4A62 Peripheral blood 4.38E-01 2.96E-02 7.85E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.29E-01 -6.88E-03 -4.48E-02
Bladder cancer 2C94 Bladder tissue 6.20E-04 -3.80E-01 -1.64E+00
Breast cancer 2C60-2C6Z Breast tissue 5.17E-56 7.59E-01 1.50E+00
Cardioembolic stroke 8B11.20 Whole blood 1.98E-02 -1.48E-01 -5.56E-01
Cervical cancer 2C77 Cervical tissue 4.00E-01 1.71E-01 2.58E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.24E-01 -1.88E-01 -2.56E-01
Chronic hepatitis C 1E51.1 Whole blood 9.28E-01 -6.14E-02 -3.13E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.58E-01 -9.23E-03 -1.25E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.09E-01 1.63E-01 2.58E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.87E-01 -2.55E-02 -6.35E-02
Colon cancer 2B90 Colon tissue 3.57E-05 -3.40E-01 -5.86E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.80E-02 -9.33E-01 -1.67E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.86E-01 1.09E-01 1.36E-01
Endometriosis GA10 Endometrium tissue 5.01E-01 1.48E-01 2.04E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.78E-01 -1.22E-01 -6.39E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.61E-05 8.47E-01 1.55E+00
Gastric cancer 2B72 Gastric tissue 2.30E-01 -6.49E-01 -1.62E+00
Glioblastopma 2A00.00 Nervous tissue 2.64E-59 5.17E-01 1.15E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.34E-01 6.05E-01 1.63E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.00E-04 -6.14E-01 -1.46E+00
Head and neck cancer 2D42 Head and neck tissue 1.03E-02 -7.37E-02 -1.44E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.01E-01 2.14E-01 5.88E-01
Huntington's disease 8A01.10 Whole blood 7.51E-01 -2.06E-02 -1.05E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.90E-01 9.66E-02 2.58E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.29E-02 -2.92E-01 -1.03E+00
Influenza 1E30 Whole blood 5.09E-01 -1.13E-01 -2.22E-01
Interstitial cystitis GC00.3 Bladder tissue 8.03E-03 6.19E-01 2.05E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.22E-02 2.37E-01 8.79E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.28E-01 9.33E-02 2.49E-01
Ischemic stroke 8B11 Peripheral blood 6.08E-02 -2.86E-01 -4.60E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.42E-05 2.25E-01 6.57E-01
Lateral sclerosis 8B60.4 Skin 2.29E-01 -4.49E-01 -9.15E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.85E-01 -9.94E-03 -4.49E-02
Liver cancer 2C12.0 Liver tissue 2.54E-02 2.11E-01 3.26E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.89E-01 1.32E-01 4.23E-01
Lung cancer 2C25 Lung tissue 1.24E-04 3.09E-01 4.05E-01
Lupus erythematosus 4A40 Whole blood 1.80E-01 9.60E-02 1.69E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.35E-01 -2.36E-02 -1.39E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.81E-01 -5.87E-02 -1.40E-01
Melanoma 2C30 Skin 4.99E-01 -4.33E-01 -3.32E-01
Multiple myeloma 2A83.1 Peripheral blood 7.82E-01 2.09E-01 4.37E-01
Multiple myeloma 2A83.1 Bone marrow 2.46E-03 -3.92E-01 -1.53E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.37E-01 6.03E-02 2.70E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.51E-01 -3.09E-02 -7.46E-02
Myelofibrosis 2A20.2 Whole blood 3.89E-01 8.59E-02 2.45E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.25E-02 -7.24E-01 -7.59E-01
Myopathy 8C70.6 Muscle tissue 6.53E-01 -1.24E-01 -2.29E-01
Neonatal sepsis KA60 Whole blood 9.26E-03 -1.99E-01 -2.93E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.49E-01 -4.66E-02 -1.31E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.72E-01 1.19E-01 5.05E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.12E-01 1.83E-01 8.30E-01
Olive pollen allergy CA08.00 Peripheral blood 1.55E-01 -8.31E-01 -1.79E+00
Oral cancer 2B6E Oral tissue 6.11E-02 3.40E-01 5.15E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.58E-01 -1.94E-01 -3.62E-01
Osteoporosis FB83.1 Bone marrow 7.75E-02 -6.20E-01 -1.14E+00
Ovarian cancer 2C73 Ovarian tissue 1.73E-01 -9.50E-02 -1.02E-01
Pancreatic cancer 2C10 Pancreas 1.77E-03 6.93E-01 1.04E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.61E-01 -1.13E-01 -4.21E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.00E-02 -3.44E-01 -9.21E-01
Pituitary cancer 2D12 Pituitary tissue 1.56E-02 -7.44E-01 -1.23E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.32E-01 -3.44E-01 -6.54E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.60E-01 1.79E-02 9.93E-02
Polycythemia vera 2A20.4 Whole blood 1.74E-01 -2.47E-01 -6.81E-01
Pompe disease 5C51.3 Biceps muscle 1.49E-01 4.00E-01 1.13E+00
Preterm birth KA21.4Z Myometrium 7.84E-01 2.04E-01 1.65E+00
Prostate cancer 2C82 Prostate 6.41E-02 1.95E-01 3.40E-01
Psoriasis EA90 Skin 8.94E-07 6.94E-01 9.64E-01
Rectal cancer 2B92 Rectal colon tissue 2.22E-03 5.44E-01 1.97E+00
Renal cancer 2C90-2C91 Kidney 1.35E-02 -3.84E-01 -1.12E+00
Retinoblastoma 2D02.2 Uvea 1.75E-03 5.60E-01 1.49E+00
Rheumatoid arthritis FA20 Synovial tissue 8.20E-01 -4.70E-04 -1.15E-03
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.33E-02 -1.31E-01 -6.84E-01
Schizophrenia 6A20 Prefrontal cortex 3.52E-01 1.76E-01 2.48E-01
Schizophrenia 6A20 Superior temporal cortex 9.70E-01 6.38E-02 7.05E-01
Scleroderma 4A42.Z Whole blood 6.63E-06 -3.46E-01 -2.18E+00
Seizure 8A60-8A6Z Whole blood 8.03E-01 2.57E-03 8.58E-03
Sensitive skin EK0Z Skin 9.05E-01 1.23E-01 4.55E-01
Sepsis with septic shock 1G41 Whole blood 2.11E-03 2.51E-01 3.63E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.26E-01 -2.21E-01 -3.17E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.90E-01 -1.31E-01 -5.96E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.92E-01 -1.94E-01 -1.08E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.78E-01 -1.01E-01 -5.62E-01
Skin cancer 2C30-2C3Z Skin 5.65E-02 1.77E-01 2.02E-01
Thrombocythemia 3B63 Whole blood 8.94E-02 -5.17E-02 -1.44E-01
Thrombocytopenia 3B64 Whole blood 9.69E-01 -1.92E-01 -1.73E-01
Thyroid cancer 2D10 Thyroid 9.76E-02 1.02E-01 1.82E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.36E-02 3.09E-01 1.17E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.61E-01 3.90E-02 1.34E-01
Type 2 diabetes 5A11 Liver tissue 2.75E-01 -1.80E-03 -7.40E-03
Ureter cancer 2C92 Urothelium 8.21E-01 -4.59E-02 -3.15E-01
Uterine cancer 2C78 Endometrium tissue 7.62E-11 5.05E-01 7.01E-01
Vitiligo ED63.0 Skin 4.80E-01 2.53E-02 3.99E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 PC and PE synthesis: mixed micellar analysis of the cholinephosphotransferase and ethanolaminephosphotransferase activities of human choline/ethanolamine phosphotransferase 1 (CEPT1). Lipids. 2002 Jul;37(7):663-72.