Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DELF8BA)

DME Name Glutamine-dependent NAD(+) synthetase (NADSYN1)
Synonyms NAD(+) synthase [glutamine-hydrolyzing]; NAD(+) synthetase; NADSYN1
Gene Name NADSYN1
UniProt ID
NADE_HUMAN
INTEDE ID
DME0155
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
55191
EC Number EC: 6.3.5.1
Ligase
Carbon-nitrogen ligase
Carbon-nitrogen ligase
EC: 6.3.5.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRGARYRLGPELEICGYGCWDHYYES
DTLLHSFQVLAALVESPVTQDIICDVGMPVMHRNVRYNCRVIFLNRKILLIRPKMALANE
GNYRELRWFTPWSRSRHTEEYFLPRMIQDLTKQETVPFGDAVLVTWDTCIGSEICEELWT
PHSPHIDMGLDGVEIITNASGSHQVLRKANTRVDLVTMVTSKNGGIYLLANQKGCDGDRL
YYDGCAMIAMNGSVFAQGSQFSLDDVEVLTATLDLEDVRSYRAEISSRNLAASRASPYPR
VKVDFALSCHEDLLAPISEPIEWKYHSPEEEISLGPACWLWDFLRRSQQAGFLLPLSGGV
DSAATACLIYSMCCQVCEAVRSGNEEVLADVRTIVNQISYTPQDPRDLCGRILTTCYMAS
KNSSQETCTRARELAQQIGSHHISLNIDPAVKAVMGIFSLVTGKSPLFAAHGGSSRENLA
LQNVQARIRMVLAYLFAQLSLWSRGVHGGLLVLGSANVDESLLGYLTKYDCSSADINPIG
GISKTDLRAFVQFCIQRFQLPALQSILLAPATAELEPLADGQVSQTDEEDMGMTYAELSV
YGKLRKVAKMGPYSMFCKLLGMWRHICTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAE
NYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDGVD
Function This enzyme catalyzes the ATP-dependent amidation of deamido-NAD to form NAD.
KEGG Pathway
Metabolic pathways (hsa01100 )
Nicotinate and nicotinamide metabolism (hsa00760 )
Reactome Pathway
Nicotinate metabolism (R-HSA-196807 )

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.32E-02 6.95E-03 3.21E-02
Alopecia ED70 Skin from scalp 3.58E-02 -1.36E-01 -5.62E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.63E-01 1.24E-02 7.68E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 9.02E-01 1.39E-02 9.50E-02
Aortic stenosis BB70 Calcified aortic valve 5.95E-01 -5.51E-02 -2.60E-01
Apnea 7A40 Hyperplastic tonsil 7.46E-01 1.71E-01 1.24E+00
Arthropathy FA00-FA5Z Peripheral blood 8.21E-01 1.53E-02 6.63E-02
Asthma CA23 Nasal and bronchial airway 6.96E-02 2.11E-01 4.86E-01
Atopic dermatitis EA80 Skin 2.68E-12 4.56E-01 2.70E+00
Autism 6A02 Whole blood 7.05E-01 1.11E-02 5.51E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.68E-01 3.03E-01 1.44E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.73E-01 -1.37E-01 -6.57E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.85E-03 -1.04E-01 -5.47E-01
Batten disease 5C56.1 Whole blood 7.65E-01 -8.63E-03 -1.13E-01
Behcet's disease 4A62 Peripheral blood 9.83E-01 -4.27E-03 -2.26E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.33E-01 -2.37E-03 -1.62E-02
Bladder cancer 2C94 Bladder tissue 4.24E-07 4.56E-01 3.25E+00
Breast cancer 2C60-2C6Z Breast tissue 2.64E-56 3.26E-01 1.18E+00
Cardioembolic stroke 8B11.20 Whole blood 4.56E-01 -6.54E-02 -3.61E-01
Cervical cancer 2C77 Cervical tissue 4.17E-05 -3.99E-01 -1.29E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.95E-01 -4.54E-02 -1.64E-01
Chronic hepatitis C 1E51.1 Whole blood 2.87E-01 -1.49E-01 -6.43E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.65E-01 -1.04E-01 -4.88E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.01E-01 1.14E-01 5.63E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.85E-02 1.03E-01 8.44E-01
Colon cancer 2B90 Colon tissue 5.60E-11 -1.26E-01 -5.32E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.01E-02 3.30E-01 9.38E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.53E-01 6.94E-02 4.00E-01
Endometriosis GA10 Endometrium tissue 7.55E-01 1.44E-02 1.00E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.61E-01 5.87E-02 3.71E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.35E-06 3.69E-01 1.64E+00
Gastric cancer 2B72 Gastric tissue 4.16E-02 2.48E-01 3.03E+00
Glioblastopma 2A00.00 Nervous tissue 2.28E-07 6.17E-02 2.64E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.39E-01 -6.31E-02 -1.23E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.22E-01 -3.34E-02 -6.66E-02
Head and neck cancer 2D42 Head and neck tissue 1.00E+00 -5.22E-04 -1.61E-03
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.19E-01 -3.31E-02 -1.89E-01
Huntington's disease 8A01.10 Whole blood 4.06E-01 2.38E-02 1.16E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.91E-03 2.64E-01 2.94E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.38E-01 2.56E-02 4.86E-01
Influenza 1E30 Whole blood 8.92E-02 1.66E-01 1.04E+01
Interstitial cystitis GC00.3 Bladder tissue 4.93E-03 -2.52E-01 -2.40E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.96E-02 2.48E-01 1.22E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.09E-01 -1.81E-01 -4.63E-01
Ischemic stroke 8B11 Peripheral blood 9.81E-01 -7.84E-02 -7.00E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.63E-09 -3.45E-01 -9.88E-01
Lateral sclerosis 8B60.4 Skin 1.71E-01 1.27E-01 9.04E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.14E-01 -6.92E-02 -4.10E-01
Liver cancer 2C12.0 Liver tissue 6.27E-01 -7.44E-02 -3.30E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.55E-02 2.33E-01 1.06E+00
Lung cancer 2C25 Lung tissue 6.41E-10 1.69E-01 6.96E-01
Lupus erythematosus 4A40 Whole blood 9.18E-05 4.50E-01 7.01E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.77E-01 -4.71E-02 -3.56E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.66E-01 -1.01E-01 -3.09E-01
Melanoma 2C30 Skin 1.14E-03 -4.50E-01 -6.91E-01
Multiple myeloma 2A83.1 Peripheral blood 3.83E-01 6.68E-02 2.49E-01
Multiple myeloma 2A83.1 Bone marrow 6.29E-05 2.69E-01 2.67E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.09E-01 9.26E-02 7.08E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.80E-01 -2.32E-02 -1.27E-01
Myelofibrosis 2A20.2 Whole blood 3.07E-02 -1.15E-02 -9.71E-02
Myocardial infarction BA41-BA50 Peripheral blood 5.21E-01 -5.69E-02 -7.70E-02
Myopathy 8C70.6 Muscle tissue 1.69E-03 1.65E-01 1.71E+00
Neonatal sepsis KA60 Whole blood 1.14E-02 1.82E-02 8.69E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.74E-03 -3.76E-01 -1.74E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.08E-02 -3.96E-01 -1.17E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.66E-01 4.64E-02 2.27E-01
Olive pollen allergy CA08.00 Peripheral blood 3.18E-01 2.02E-01 8.36E-01
Oral cancer 2B6E Oral tissue 1.05E-01 -1.73E-01 -4.97E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.77E-01 2.15E-01 4.12E-01
Osteoporosis FB83.1 Bone marrow 2.70E-01 2.51E-02 1.29E-01
Ovarian cancer 2C73 Ovarian tissue 6.03E-02 2.25E-01 9.00E-01
Pancreatic cancer 2C10 Pancreas 9.10E-03 2.49E-01 9.01E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.69E-01 5.95E-02 4.27E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.80E-01 -1.84E-02 -1.51E-01
Pituitary cancer 2D12 Pituitary tissue 1.55E-02 -1.71E-01 -9.09E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.51E-01 -1.01E-01 -3.95E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.30E-01 -4.84E-02 -5.72E-01
Polycythemia vera 2A20.4 Whole blood 3.42E-03 -2.51E-02 -2.40E-01
Pompe disease 5C51.3 Biceps muscle 6.71E-03 2.16E-01 1.08E+00
Preterm birth KA21.4Z Myometrium 6.31E-01 -2.02E-01 -6.20E-01
Prostate cancer 2C82 Prostate 2.34E-04 6.69E-01 1.32E+00
Psoriasis EA90 Skin 1.24E-23 3.13E-01 1.10E+00
Rectal cancer 2B92 Rectal colon tissue 1.96E-01 -1.09E-01 -5.13E-01
Renal cancer 2C90-2C91 Kidney 3.29E-02 1.45E-01 7.82E-01
Retinoblastoma 2D02.2 Uvea 2.50E-07 6.09E-01 3.30E+00
Rheumatoid arthritis FA20 Synovial tissue 1.72E-04 4.96E-01 2.52E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.45E-01 3.99E-02 2.82E-01
Schizophrenia 6A20 Prefrontal cortex 9.81E-02 4.36E-02 7.26E-02
Schizophrenia 6A20 Superior temporal cortex 1.37E-01 -4.44E-02 -2.56E-01
Scleroderma 4A42.Z Whole blood 6.29E-02 1.57E-01 1.10E+00
Seizure 8A60-8A6Z Whole blood 4.70E-01 7.10E-02 3.74E-01
Sensitive skin EK0Z Skin 8.42E-01 1.58E-02 1.25E-01
Sepsis with septic shock 1G41 Whole blood 7.22E-12 1.35E-01 6.13E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.69E-01 -1.31E-01 -6.46E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.59E-01 2.92E-02 1.04E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.74E-01 3.56E-01 1.99E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.11E-02 1.34E-01 1.49E+00
Skin cancer 2C30-2C3Z Skin 7.50E-01 -5.71E-03 -1.31E-02
Thrombocythemia 3B63 Whole blood 7.45E-01 5.88E-02 5.28E-01
Thrombocytopenia 3B64 Whole blood 3.00E-01 1.79E-01 2.35E-01
Thyroid cancer 2D10 Thyroid 1.61E-11 2.21E-01 1.20E+00
Tibial muscular dystrophy 8C75 Muscle tissue 3.79E-04 2.94E-01 1.30E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.95E-02 2.50E-01 2.03E+00
Type 2 diabetes 5A11 Liver tissue 3.92E-01 -2.44E-01 -7.92E-01
Ureter cancer 2C92 Urothelium 9.89E-01 1.10E-02 8.29E-02
Uterine cancer 2C78 Endometrium tissue 1.69E-01 1.02E-03 2.57E-03
Vitiligo ED63.0 Skin 4.06E-02 1.68E-01 1.28E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases