Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEMH6UB)

DME Name Lysosomal beta A mannosidase (MANBA)
Synonyms Beta-mannosidase; Beta-D-mannosidase; Beta-mannoside mannohydrolase A; Exo-beta-D-mannanase; Lysosomal beta A mannosidase; Mannanase; Mannase; MANB1; MANBA
Gene Name MANBA
UniProt ID
MANBA_HUMAN
INTEDE ID
DME0511
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4126
EC Number EC: 3.2.1.25
Hydrolases
Glycosylase
O/S-glycosyl compound glycosidase
EC: 3.2.1.25
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MRLHLLLLLALCGAGTTAAELSYSLRGNWSICNGNGSLELPGAVPGCVHSALFQQGLIQD
SYYRFNDLNYRWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETD
NMFNRYSFDITNVVRDVNSIELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNF
VRKEQCSFSWDWGPSFPTQGIWKDVRIEAYNICHLNYFTFSPIYDKSAQEWNLEIESTFD
VVSSKPVGGQVIVAIPKLQTQQTYSIELQPGKRIVELFVNISKNITVETWWPHGHGNQTG
YNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPIFLKGSNWIPA
DSFQDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFACA
LYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKD
YVTLYVKNIRELVLAGDKSRPFITSSPTNGAETVAEAWVSQNPNSNYFGDVHFYDYISDC
WNWKVFPKARFASEYGYQSWPSFSTLEKVSSTEDWSFNSKFSLHRQHHEGGNKQMLYQAG
LHFKLPQSTDPLRTFKDTIYLTQVMQAQCVKTETEFYRRSRSEIVDQQGHTMGALYWQLN
DIWQAPSWASLEYGGKWKMLHYFAQNFFAPLLPVGFENENTFYIYGVSDLHSDYSMTLSV
RVHTWSSLEPVCSRVTERFVMKGGEAVCLYEEPVSELLRRCGNCTRESCVVSFYLSADHE
LLSPTNYHFLSSPKEAVGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLDVGSIPGRFS
DNGFLMTEKTRTILFYPWEPTSKNELEQSFHVTSLTDIY
Function This enzyme cleaves the single beta-linked mannose residue from the non-reducing end of all N-linked glycoprotein oligosaccharides.
KEGG Pathway
Lysosome (hsa04142 )
Other glycan degradation (hsa00511 )
Reactome Pathway
Neutrophil degranulation (R-HSA-6798695 )
Lysosomal oligosaccharide catabolism (R-HSA-8853383 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
P-nitrophenyl DM7LPCE N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.76E-06 2.80E-01 7.71E-01
Alopecia ED70 Skin from scalp 5.30E-02 1.92E-02 9.04E-02
Alzheimer's disease 8A20 Entorhinal cortex 3.45E-05 1.67E-01 6.51E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.51E-02 1.85E-01 6.89E-01
Aortic stenosis BB70 Calcified aortic valve 8.25E-01 9.89E-02 8.83E-02
Apnea 7A40 Hyperplastic tonsil 4.34E-01 1.38E-01 4.44E-01
Arthropathy FA00-FA5Z Peripheral blood 5.87E-02 1.94E-01 8.85E-01
Asthma CA23 Nasal and bronchial airway 1.53E-03 1.65E-01 3.92E-01
Atopic dermatitis EA80 Skin 2.16E-01 -1.29E-01 -6.69E-01
Autism 6A02 Whole blood 2.86E-05 4.13E-01 1.33E+00
Autoimmune uveitis 9A96 Peripheral monocyte 3.60E-01 1.89E-01 8.92E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.70E-01 -1.89E-02 -5.61E-02
Bacterial infection of gingival 1C1H Gingival tissue 9.76E-01 2.65E-02 9.29E-02
Batten disease 5C56.1 Whole blood 2.10E-01 2.41E-01 7.87E-01
Behcet's disease 4A62 Peripheral blood 9.55E-01 9.58E-03 4.65E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.86E-01 4.38E-02 2.48E-01
Bladder cancer 2C94 Bladder tissue 3.36E-04 -3.48E-01 -1.96E+00
Breast cancer 2C60-2C6Z Breast tissue 5.48E-25 3.35E-01 8.07E-01
Cardioembolic stroke 8B11.20 Whole blood 7.00E-01 1.02E-01 5.98E-01
Cervical cancer 2C77 Cervical tissue 7.15E-02 -2.73E-01 -5.73E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.94E-01 -4.11E-03 -8.80E-03
Chronic hepatitis C 1E51.1 Whole blood 7.22E-01 1.40E-01 3.48E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.89E-01 4.71E-02 2.04E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.06E-01 -4.99E-02 -1.53E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.24E-02 -2.74E-01 -1.92E+00
Colon cancer 2B90 Colon tissue 1.75E-15 2.13E-01 6.32E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.37E-02 3.88E-01 1.33E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.79E-02 2.06E-01 4.89E-01
Endometriosis GA10 Endometrium tissue 9.24E-01 2.32E-01 2.94E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.14E-01 -3.00E-02 -1.69E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.03E-14 1.38E+00 2.18E+00
Gastric cancer 2B72 Gastric tissue 1.74E-01 2.28E-01 9.79E-01
Glioblastopma 2A00.00 Nervous tissue 6.01E-52 4.26E-01 1.03E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.08E-06 -5.56E-01 -3.98E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.82E-01 -3.06E-01 -4.32E-01
Head and neck cancer 2D42 Head and neck tissue 1.28E-05 1.33E-01 3.86E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.93E-01 2.05E-01 4.36E-01
Huntington's disease 8A01.10 Whole blood 9.07E-01 9.35E-02 6.74E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.81E-01 8.88E-02 4.93E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.68E-02 -1.16E-01 -5.68E-01
Influenza 1E30 Whole blood 2.77E-01 -5.90E-01 -9.19E-01
Interstitial cystitis GC00.3 Bladder tissue 2.94E-01 1.38E-02 2.85E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.98E-04 5.30E-01 2.52E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.87E-01 -1.87E-02 -9.05E-02
Ischemic stroke 8B11 Peripheral blood 3.46E-01 -7.13E-02 -2.05E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.67E-01 4.92E-02 2.15E-01
Lateral sclerosis 8B60.4 Skin 2.74E-02 -3.28E-01 -1.82E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 9.71E-01 1.11E-01 3.99E-01
Liver cancer 2C12.0 Liver tissue 4.72E-02 9.42E-03 2.40E-02
Liver failure DB99.7-DB99.8 Liver tissue 5.89E-05 1.19E+00 3.07E+00
Lung cancer 2C25 Lung tissue 3.14E-06 -1.05E-01 -2.95E-01
Lupus erythematosus 4A40 Whole blood 5.08E-04 4.42E-01 5.40E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.94E-01 9.64E-03 5.65E-02
Major depressive disorder 6A70-6A7Z Whole blood 1.62E-02 1.25E-01 5.42E-01
Melanoma 2C30 Skin 4.79E-01 6.57E-02 9.09E-02
Multiple myeloma 2A83.1 Peripheral blood 4.46E-01 1.89E-01 5.73E-01
Multiple myeloma 2A83.1 Bone marrow 9.47E-05 8.49E-01 2.78E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.02E-01 -6.52E-02 -3.15E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.62E-03 1.38E-01 3.72E-01
Myelofibrosis 2A20.2 Whole blood 3.56E-03 -2.48E-01 -1.66E+00
Myocardial infarction BA41-BA50 Peripheral blood 9.14E-01 4.63E-02 9.18E-02
Myopathy 8C70.6 Muscle tissue 3.60E-02 3.62E-01 8.54E-01
Neonatal sepsis KA60 Whole blood 1.36E-07 3.45E-01 7.36E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.69E-01 1.28E-01 5.58E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 1.46E-01 -1.36E-01 -5.00E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.87E-01 7.09E-03 2.56E-02
Olive pollen allergy CA08.00 Peripheral blood 2.75E-01 -1.79E-01 -3.00E-01
Oral cancer 2B6E Oral tissue 2.61E-03 4.49E-01 7.10E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.16E-01 -1.85E-01 -2.89E-01
Osteoporosis FB83.1 Bone marrow 7.77E-01 -1.97E-01 -2.52E-01
Ovarian cancer 2C73 Ovarian tissue 9.29E-01 -9.87E-02 -2.03E-01
Pancreatic cancer 2C10 Pancreas 3.71E-03 3.83E-01 1.05E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.87E-02 3.76E-01 9.55E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.28E-01 9.59E-02 3.87E-01
Pituitary cancer 2D12 Pituitary tissue 2.41E-03 3.05E-01 9.57E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.98E-03 5.85E-01 1.65E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.13E-01 1.05E-01 6.01E-01
Polycythemia vera 2A20.4 Whole blood 1.75E-01 -2.93E-02 -1.80E-01
Pompe disease 5C51.3 Biceps muscle 8.73E-02 2.54E-01 1.37E+00
Preterm birth KA21.4Z Myometrium 1.85E-01 2.97E-01 9.06E-01
Prostate cancer 2C82 Prostate 1.84E-01 6.35E-01 7.90E-01
Psoriasis EA90 Skin 9.74E-06 4.22E-02 1.07E-01
Rectal cancer 2B92 Rectal colon tissue 2.58E-01 -2.13E-01 -8.46E-01
Renal cancer 2C90-2C91 Kidney 2.95E-06 1.11E+00 3.09E+00
Retinoblastoma 2D02.2 Uvea 2.72E-05 1.13E+00 4.94E+00
Rheumatoid arthritis FA20 Synovial tissue 2.51E-02 8.53E-01 1.50E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.26E-01 5.03E-02 3.59E-01
Schizophrenia 6A20 Prefrontal cortex 2.25E-01 -8.28E-02 -1.03E-01
Schizophrenia 6A20 Superior temporal cortex 6.36E-01 2.22E-02 1.86E-01
Scleroderma 4A42.Z Whole blood 1.82E-01 -4.36E-03 -2.41E-02
Seizure 8A60-8A6Z Whole blood 2.04E-01 -7.87E-02 -1.91E-01
Sensitive skin EK0Z Skin 7.93E-01 3.82E-02 3.26E-01
Sepsis with septic shock 1G41 Whole blood 9.66E-01 -4.27E-02 -9.65E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.68E-02 -4.31E-01 -1.90E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.83E-01 -5.09E-02 -8.90E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 5.21E-03 4.16E-01 2.96E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.24E-01 2.95E-02 1.97E-01
Skin cancer 2C30-2C3Z Skin 7.11E-22 5.81E-01 1.20E+00
Thrombocythemia 3B63 Whole blood 1.30E-01 -1.20E-01 -8.24E-01
Thrombocytopenia 3B64 Whole blood 8.31E-01 -2.78E-01 -4.21E-01
Thyroid cancer 2D10 Thyroid 6.10E-01 -5.05E-02 -1.98E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.27E-05 5.18E-01 1.44E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.16E-02 3.56E-01 3.61E+00
Type 2 diabetes 5A11 Liver tissue 6.81E-01 -2.46E-02 -7.92E-02
Ureter cancer 2C92 Urothelium 2.31E-01 5.83E-02 2.46E-01
Uterine cancer 2C78 Endometrium tissue 6.61E-04 7.72E-02 1.59E-01
Vitiligo ED63.0 Skin 9.41E-01 -1.22E-01 -3.80E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Cloning, sequence, expression and characterization of human beta-mannosidase. Acta Biochim Pol. 2008;55(3):479-90.