Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEMK5U6)

DME Name Acyl-CoA thioesterase 13 (ACOT13)
Synonyms Acyl-coenzyme A thioesterase 13; Acyl-coenzyme A thioesterase 13, N-terminally processed; HT012; PNAS-27; THEM2; ACOT13; Thioesterase superfamily member 2
Gene Name ACOT13
UniProt ID
ACO13_HUMAN
INTEDE ID
DME0516
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
55856
EC Number EC: 3.1.2.20
Hydrolases
Ester bond hydrolase
Thioester hydrolase
EC: 3.1.2.20
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLT
ATLVDNISTMALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDL
TNKATGKLIAQGRHTKHLGN
Function
This enzyme catalyzes the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. It has acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. It can also hydrolyze 3-hydroxyphenylacetyl-CoA and 3,4- dihydroxyphenylacetyl-CoA in vitro.
Reactome Pathway
Mitochondrial Fatty Acid Beta-Oxidation (R-HSA-77289 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Hydroxybutyryl-CoA DM0PCWZ N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.52E-01 -4.83E-02 -7.19E-02
Alopecia ED70 Skin from scalp 1.85E-01 8.34E-02 2.08E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.50E-01 -2.20E-02 -7.30E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 1.26E-01 1.38E-01 3.72E-01
Aortic stenosis BB70 Calcified aortic valve 8.52E-01 -2.34E-01 -5.10E-01
Apnea 7A40 Hyperplastic tonsil 5.22E-04 -9.52E-01 -1.85E+00
Arthropathy FA00-FA5Z Peripheral blood 9.16E-01 2.95E-02 1.25E-01
Asthma CA23 Nasal and bronchial airway 1.90E-03 5.18E-01 5.91E-01
Atopic dermatitis EA80 Skin 1.49E-03 -2.72E-01 -1.16E+00
Autism 6A02 Whole blood 8.49E-01 2.05E-01 3.45E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.40E-01 6.76E-01 1.12E+00
Autosomal dominant monocytopenia 4B04 Whole blood 5.57E-02 -4.29E-01 -8.41E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.25E-01 2.12E-02 5.60E-02
Batten disease 5C56.1 Whole blood 8.99E-01 9.96E-02 8.20E-01
Behcet's disease 4A62 Peripheral blood 7.66E-01 2.60E-02 9.36E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.09E-01 2.54E-02 1.11E-01
Bladder cancer 2C94 Bladder tissue 9.92E-03 -3.35E-01 -2.78E+00
Breast cancer 2C60-2C6Z Breast tissue 2.53E-17 6.61E-01 8.41E-01
Cardioembolic stroke 8B11.20 Whole blood 3.07E-01 1.60E-01 4.49E-01
Cervical cancer 2C77 Cervical tissue 2.66E-05 3.91E-01 1.38E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.64E-02 4.62E-02 1.27E-01
Chronic hepatitis C 1E51.1 Whole blood 9.44E-01 -4.87E-02 -9.66E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 8.03E-01 -2.82E-02 -7.49E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.01E-01 3.52E-03 8.69E-03
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.02E-02 2.07E-01 6.87E-01
Colon cancer 2B90 Colon tissue 2.84E-44 -5.49E-01 -1.39E+00
Coronary artery disease BA80-BA8Z Peripheral blood 7.00E-02 2.53E-01 6.31E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.73E-01 -3.38E-01 -7.97E-01
Endometriosis GA10 Endometrium tissue 8.00E-01 -3.15E-01 -3.24E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.00E-01 1.88E-01 6.91E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.03E-11 1.14E+00 1.69E+00
Gastric cancer 2B72 Gastric tissue 5.79E-01 2.68E-01 2.25E-01
Glioblastopma 2A00.00 Nervous tissue 1.28E-07 -2.16E-01 -4.20E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.51E-01 -1.31E-01 -2.97E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.72E-03 1.19E+00 1.00E+00
Head and neck cancer 2D42 Head and neck tissue 2.86E-03 1.97E-01 3.75E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.30E-01 -1.60E-01 -4.23E-01
Huntington's disease 8A01.10 Whole blood 6.07E-01 4.13E-02 9.54E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.00E-01 -1.41E-02 -6.56E-02
Immunodeficiency 4A00-4A20 Peripheral blood 4.97E-06 5.28E-01 3.04E+00
Influenza 1E30 Whole blood 1.36E-02 -2.81E-01 -1.99E+00
Interstitial cystitis GC00.3 Bladder tissue 2.43E-03 -1.89E-01 -2.06E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.24E-04 6.21E-01 1.37E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.91E-03 -5.49E-01 -8.35E-01
Ischemic stroke 8B11 Peripheral blood 4.36E-02 -1.75E-01 -6.48E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.46E-09 -1.94E-01 -6.43E-01
Lateral sclerosis 8B60.4 Skin 9.54E-01 -3.62E-02 -2.00E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.79E-01 -4.12E-01 -4.96E-01
Liver cancer 2C12.0 Liver tissue 1.94E-02 -6.94E-01 -7.34E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.09E-03 -7.27E-01 -2.15E+00
Lung cancer 2C25 Lung tissue 5.84E-18 4.56E-01 9.95E-01
Lupus erythematosus 4A40 Whole blood 7.02E-09 7.92E-01 7.89E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.52E-01 -1.68E-02 -9.57E-02
Major depressive disorder 6A70-6A7Z Whole blood 9.71E-01 -1.68E-02 -2.78E-02
Melanoma 2C30 Skin 4.69E-02 -3.42E-01 -3.96E-01
Multiple myeloma 2A83.1 Peripheral blood 4.38E-01 -1.19E-02 -1.02E-02
Multiple myeloma 2A83.1 Bone marrow 6.33E-04 7.20E-01 2.04E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.65E-01 -4.58E-01 -9.96E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.42E-03 1.46E-01 3.53E-01
Myelofibrosis 2A20.2 Whole blood 2.67E-03 3.96E-01 1.68E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.72E-04 -6.78E-01 -8.13E-01
Myopathy 8C70.6 Muscle tissue 1.21E-01 8.39E-02 4.21E-01
Neonatal sepsis KA60 Whole blood 3.48E-17 6.04E-01 1.30E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.37E-03 6.43E-01 1.33E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.78E-01 1.85E-01 4.25E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.78E-01 1.28E-01 5.48E-01
Olive pollen allergy CA08.00 Peripheral blood 3.27E-01 7.48E-01 9.45E-01
Oral cancer 2B6E Oral tissue 1.75E-03 9.68E-01 1.37E+00
Osteoarthritis FA00-FA0Z Synovial tissue 7.82E-01 -2.96E-02 -3.26E-02
Osteoporosis FB83.1 Bone marrow 3.21E-01 4.96E-02 1.47E-01
Ovarian cancer 2C73 Ovarian tissue 2.73E-04 1.13E+00 1.57E+00
Pancreatic cancer 2C10 Pancreas 2.59E-04 4.41E-01 1.53E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 3.71E-01 -4.28E-02 -9.32E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.17E-06 3.55E-01 1.63E+00
Pituitary cancer 2D12 Pituitary tissue 6.55E-01 -1.99E-01 -3.07E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.82E-01 -2.49E-01 -6.33E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.58E-02 -9.88E-02 -4.24E-01
Polycythemia vera 2A20.4 Whole blood 1.40E-09 3.11E-01 1.34E+00
Pompe disease 5C51.3 Biceps muscle 1.81E-02 3.12E-01 1.66E+00
Preterm birth KA21.4Z Myometrium 1.60E-02 6.44E-01 1.33E+00
Prostate cancer 2C82 Prostate 4.02E-01 2.05E-01 2.98E-01
Psoriasis EA90 Skin 6.53E-11 2.85E-01 6.85E-01
Rectal cancer 2B92 Rectal colon tissue 5.73E-07 -6.96E-01 -3.86E+00
Renal cancer 2C90-2C91 Kidney 8.69E-01 -2.55E-02 -3.72E-02
Retinoblastoma 2D02.2 Uvea 6.84E-01 -3.68E-02 -2.58E-01
Rheumatoid arthritis FA20 Synovial tissue 4.80E-02 3.89E-01 6.40E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.41E-01 3.58E-02 1.52E-01
Schizophrenia 6A20 Prefrontal cortex 3.83E-02 -4.38E-01 -8.34E-01
Schizophrenia 6A20 Superior temporal cortex 5.65E-02 -5.48E-02 -2.73E-01
Scleroderma 4A42.Z Whole blood 6.31E-02 1.57E-01 7.88E-01
Seizure 8A60-8A6Z Whole blood 2.50E-02 6.09E-01 1.65E+00
Sensitive skin EK0Z Skin 1.28E-01 -9.18E-02 -5.01E-01
Sepsis with septic shock 1G41 Whole blood 3.19E-37 5.05E-01 1.26E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.60E-02 -4.46E-01 -1.12E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.56E-01 1.04E-01 2.19E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.17E-01 -6.09E-02 -2.64E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.24E-01 -4.59E-01 -1.14E+00
Skin cancer 2C30-2C3Z Skin 8.77E-02 -2.98E-02 -6.19E-02
Thrombocythemia 3B63 Whole blood 1.15E-03 1.96E-01 8.34E-01
Thrombocytopenia 3B64 Whole blood 9.31E-01 -1.67E-01 -3.30E-01
Thyroid cancer 2D10 Thyroid 1.21E-03 1.75E-01 4.83E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.51E-01 -2.01E-01 -5.17E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.20E-02 -4.00E-01 -1.74E+00
Type 2 diabetes 5A11 Liver tissue 4.32E-01 3.84E-02 1.06E-01
Ureter cancer 2C92 Urothelium 3.85E-02 1.53E-01 8.34E-01
Uterine cancer 2C78 Endometrium tissue 2.88E-02 2.36E-01 2.99E-01
Vitiligo ED63.0 Skin 1.38E-01 -1.55E-01 -7.47E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The mechanisms of human hotdog-fold thioesterase 2 (hTHEM2) substrate recognition and catalysis illuminated by a structure and function based analysis. Biochemistry. 2009 Feb 17;48(6):1293-304.