Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DEMQRS9)
| DME Name | Cytochrome P450 BM3 (cypBM3) | ||||
|---|---|---|---|---|---|
| Synonyms | Cytochrome P450 family 102 subfamily A member 3; Cytochrome cypBM3; P450 BM3; cypBM3 | ||||
| Gene Name | cypBM3 | ||||
| UniProt ID | |||||
| INTEDE ID | |||||
| EC Number | EC: 1.14.14.1 | ||||
| Lineage | Species: Bacillus megaterium | ||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
DKPVQLGCKFADELGEIFKFEAPGRVTRYLSSQRLIKEACDESRFDKNLSQALKFVRDFA
GDGLFTSWTHEKNWKKAHNILLPSFSQQAMKGYHAMMVDIAVQLIQKWERLNADEHIEVP EDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFITSMVRALDEAMNKLQRANPDDPAYDENK RQFQDDIKVMNDLVDKIIADRKASGEQSDDLLTHYAKRKDPETGEPLDDENIRYQIITFL IAGHETT |
||||
| Function |
This enzyme is P-450 heme-thiolate protein, acting on a wide range of substrates including many xenobiotics, steroids, fatty acids, vitamins and prostaglandins; reactions catalysed include hydroxylation, epoxidation, N-oxidation, sulfooxidation, N-, S- and O-dealkylations, desulfation, deamination, and reduction of azo, nitro and N-oxide groups.
|
||||
Molecular Interaction Atlas (MIA) of This DME
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Discontinued Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||
|
2 Investigative Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||