General Information of Drug-Metabolizing Enzyme (DME) (ID: DEMQTKH)

DME Name HIF-prolyl hydroxylase 3 (EGLN3)
Synonyms Hypoxia-inducible factor prolyl hydroxylase 3; Egl nine homolog 3; Prolyl hydroxylase domain-containing protein 3; EGLN3; HIF-PH3; HPH-1; HPH-3; PHD3
Gene Name EGLN3
UniProt ID
EGLN3_HUMAN
INTEDE ID
DME0507
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
112399
EC Number EC: 1.14.11.29
Oxidoreductase
Oxygen paired donor oxidoreductase
2-oxoglutarate donor oxidoreductase
EC: 1.14.11.29
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQ
LAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
Function This enzyme is able to catalyze the hydroxylation of proteins such as the subunits of hypoxia-inducible factor.
KEGG Pathway
HIF-1 signaling pathway (hsa04066 )
Pathways in cancer (hsa05200 )
Renal cell carcinoma (hsa05211 )
Reactome Pathway
Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha (R-HSA-1234176 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
alpha-ketoglutaric acid DM5LFYN Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
alpha-ketoglutaric acid Discovery agent [N.A.] Investigative Km = 0.055 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.24E-16 -1.35E-01 -8.76E-01
Alopecia ED70 Skin from scalp 1.64E-03 2.28E-01 4.63E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.87E-03 1.28E-01 3.29E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.03E-02 -8.17E-01 -8.97E-01
Aortic stenosis BB70 Calcified aortic valve 5.96E-02 -2.02E-01 -4.62E-01
Apnea 7A40 Hyperplastic tonsil 9.66E-01 2.79E-01 3.05E-01
Arthropathy FA00-FA5Z Peripheral blood 2.25E-02 9.18E-02 7.24E-01
Asthma CA23 Nasal and bronchial airway 2.79E-04 4.01E-01 5.09E-01
Atopic dermatitis EA80 Skin 1.26E-05 -7.78E-01 -2.04E+00
Autism 6A02 Whole blood 7.13E-01 1.79E-02 8.38E-02
Autoimmune uveitis 9A96 Peripheral monocyte 1.56E-01 -1.50E-01 -1.63E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.72E-02 -9.99E-02 -1.06E+00
Bacterial infection of gingival 1C1H Gingival tissue 5.52E-11 -6.46E-01 -1.14E+00
Batten disease 5C56.1 Whole blood 8.49E-01 5.47E-02 1.01E-01
Behcet's disease 4A62 Peripheral blood 5.87E-03 -2.43E-01 -9.72E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.86E-01 1.14E-01 3.09E-01
Bladder cancer 2C94 Bladder tissue 5.61E-04 5.26E-01 2.31E+00
Breast cancer 2C60-2C6Z Breast tissue 1.27E-33 6.01E-01 8.72E-01
Cardioembolic stroke 8B11.20 Whole blood 9.33E-01 -1.67E-01 -4.22E-01
Cervical cancer 2C77 Cervical tissue 2.04E-01 3.54E-01 3.76E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.62E-01 4.78E-02 3.30E-01
Chronic hepatitis C 1E51.1 Whole blood 7.56E-01 5.20E-02 2.34E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.08E-01 -1.35E-02 -3.39E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.39E-03 2.31E-01 5.25E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.07E-02 7.49E-01 1.54E+00
Colon cancer 2B90 Colon tissue 3.82E-43 -1.51E+00 -1.91E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.04E-01 1.34E-01 6.44E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.62E-01 1.43E-01 6.48E-01
Endometriosis GA10 Endometrium tissue 6.44E-01 9.26E-02 2.10E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.68E-01 6.36E-02 3.84E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.32E-01 8.22E-02 3.70E-01
Gastric cancer 2B72 Gastric tissue 3.26E-02 2.36E-03 4.56E-02
Glioblastopma 2A00.00 Nervous tissue 1.88E-02 -1.81E-01 -3.11E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.72E-01 -1.89E-01 -1.45E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.17E-01 3.08E-01 3.98E-01
Head and neck cancer 2D42 Head and neck tissue 2.74E-21 8.85E-01 1.77E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.74E-01 9.21E-02 3.08E-01
Huntington's disease 8A01.10 Whole blood 9.50E-01 3.65E-02 3.09E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.55E-01 -2.86E-01 -8.05E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.63E-02 3.08E-01 2.10E+00
Influenza 1E30 Whole blood 2.87E-01 6.45E-02 1.00E+00
Interstitial cystitis GC00.3 Bladder tissue 1.37E-03 -8.54E-01 -3.01E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.48E-02 -3.49E-01 -8.54E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.53E-02 1.48E-01 2.97E-01
Ischemic stroke 8B11 Peripheral blood 8.27E-01 -9.41E-02 -4.35E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.04E-03 2.75E-01 6.31E-01
Lateral sclerosis 8B60.4 Skin 1.80E-01 -7.60E-02 -9.49E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.08E-01 -9.42E-03 -2.98E-02
Liver cancer 2C12.0 Liver tissue 3.20E-17 1.67E-01 9.44E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.99E-01 1.31E-01 1.11E+00
Lung cancer 2C25 Lung tissue 1.16E-147 1.80E+00 3.78E+00
Lupus erythematosus 4A40 Whole blood 6.67E-01 6.57E-03 1.23E-02
Major depressive disorder 6A70-6A7Z Hippocampus 1.47E-01 -8.53E-02 -2.30E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.98E-02 1.13E-01 3.08E-01
Melanoma 2C30 Skin 3.06E-01 -9.80E-01 -5.99E-01
Multiple myeloma 2A83.1 Peripheral blood 2.06E-02 2.11E-01 9.34E-01
Multiple myeloma 2A83.1 Bone marrow 3.42E-04 -5.01E-01 -2.12E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.59E-01 3.51E-02 9.97E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.04E-03 1.11E-01 3.93E-01
Myelofibrosis 2A20.2 Whole blood 3.62E-02 3.85E-02 2.69E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.20E-01 -1.21E-01 -1.67E-01
Myopathy 8C70.6 Muscle tissue 7.92E-05 7.30E-01 2.42E+00
Neonatal sepsis KA60 Whole blood 3.65E-01 -8.39E-03 -5.14E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.63E-07 -9.99E-01 -3.62E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.80E-01 -4.08E-02 -3.87E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.33E-01 -6.30E-01 -4.05E-01
Olive pollen allergy CA08.00 Peripheral blood 7.79E-04 2.56E-01 3.04E+00
Oral cancer 2B6E Oral tissue 2.21E-06 9.20E-01 1.25E+00
Osteoarthritis FA00-FA0Z Synovial tissue 4.75E-01 -2.65E-01 -5.61E-01
Osteoporosis FB83.1 Bone marrow 1.62E-04 2.17E-01 4.38E+00
Ovarian cancer 2C73 Ovarian tissue 1.64E-06 1.57E+00 3.27E+00
Pancreatic cancer 2C10 Pancreas 1.25E-02 8.52E-01 7.31E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.41E-01 1.38E-01 4.53E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.45E-01 1.21E-03 9.02E-03
Pituitary cancer 2D12 Pituitary tissue 5.67E-03 5.44E-01 1.14E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.13E-02 8.67E-01 1.72E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.70E-04 -1.79E-01 -1.42E+00
Polycythemia vera 2A20.4 Whole blood 1.85E-03 1.04E-01 8.35E-01
Pompe disease 5C51.3 Biceps muscle 7.65E-02 3.99E-01 1.04E+00
Preterm birth KA21.4Z Myometrium 3.99E-01 -1.87E-01 -2.23E-01
Prostate cancer 2C82 Prostate 9.27E-01 6.69E-01 5.12E-01
Psoriasis EA90 Skin 1.66E-07 6.36E-01 9.40E-01
Rectal cancer 2B92 Rectal colon tissue 1.76E-03 -8.79E-01 -1.85E+00
Renal cancer 2C90-2C91 Kidney 2.37E-25 3.44E+00 1.13E+01
Retinoblastoma 2D02.2 Uvea 2.06E-01 4.37E-01 1.22E+00
Rheumatoid arthritis FA20 Synovial tissue 2.88E-01 -5.67E-01 -1.23E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.28E-02 9.95E-02 1.88E-01
Schizophrenia 6A20 Prefrontal cortex 1.91E-01 -1.37E-01 -2.13E-01
Schizophrenia 6A20 Superior temporal cortex 5.74E-01 6.05E-02 2.96E-01
Scleroderma 4A42.Z Whole blood 3.17E-03 1.25E-01 1.06E+00
Seizure 8A60-8A6Z Whole blood 5.75E-01 -5.11E-02 -2.66E-01
Sensitive skin EK0Z Skin 5.02E-01 -2.71E-01 -1.22E+00
Sepsis with septic shock 1G41 Whole blood 9.25E-01 -2.61E-02 -1.53E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.02E-01 -7.08E-02 -6.74E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.61E-03 1.05E+00 2.26E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.01E-02 2.16E-01 2.51E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.21E-01 -3.27E-02 -1.04E-01
Skin cancer 2C30-2C3Z Skin 9.33E-90 -2.24E+00 -3.26E+00
Thrombocythemia 3B63 Whole blood 1.79E-01 7.18E-02 4.97E-01
Thrombocytopenia 3B64 Whole blood 7.35E-01 1.38E-01 3.63E-01
Thyroid cancer 2D10 Thyroid 4.66E-17 3.04E-01 1.15E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.76E-09 7.86E-01 3.57E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.87E-01 5.25E-03 2.15E-02
Type 2 diabetes 5A11 Liver tissue 6.56E-02 7.78E-02 2.26E+00
Ureter cancer 2C92 Urothelium 6.55E-01 -7.30E-03 -2.81E-02
Uterine cancer 2C78 Endometrium tissue 2.54E-29 1.54E+00 1.86E+00
Vitiligo ED63.0 Skin 9.40E-01 9.22E-02 1.94E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Characterization of the human prolyl 4-hydroxylases that modify the hypoxia-inducible factor. J Biol Chem. 2003 Aug 15;278(33):30772-80.