Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEMWKYT)

DME Name Neutral alpha-glucosidase AB (GANAB)
Synonyms Alpha-glucosidase 2; Glucosidase II subunit alpha; G2AN; GANAB; KIAA0088
Gene Name GANAB
UniProt ID
GANAB_HUMAN
INTEDE ID
DME0547
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
23193
EC Number EC: 3.2.1.207
Hydrolases
Glycosylase
O/S-glycosyl compound glycosidase
EC: 3.2.1.207
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSIRPGLSPY
RALLDSLQLGPDSLTVHLIHEVTKVLLVLELQGLQKNMTRFRIDELEPRRPRYRVPDVLV
ADPPIARLSVSGRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEH
QRAPRVSQGSKDPAEGDGAQPEETPRDGDKPEETQGKAEKDEPGAWEETFKTHSDSKPYG
PMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRLYNLDVFQYELYNPMALYGSVP
VLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMMDYLQGSGETPQTDVRWMSETG
IIDVFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHN
LPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVDPHIKVDSGYRVH
EELRNLGLYVKTRDGSDYEGWCWPGSAGYPDFTNPTMRAWWANMFSYDNYEGSAPNLFVW
NDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYVHMATADGLRQRSGGMERPFVL
ARAFFAGSQRFGAVWTGDNTAEWDHLKISIPMCLSLGLVGLSFCGADVGGFFKNPEPELL
VRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYSLLPFWYTLLYQAHR
EGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPGQGEVWYDIQ
SYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSECMKDDPITLFVALSPQGTA
QGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSSSADPEGHFETPIWIERVVIIGAGKP
AAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR
Function This enzyme cleaves sequentially the 2 innermost alpha-1,3-linked glucose residues from the Glc(2)Man(9)GlcNAc(2) oligosaccharide precursor of immature glycoproteins.
KEGG Pathway
Metabolic pathways (hsa01100 )
N-Glycan biosynthesis (hsa00510 )
Protein processing in endoplasmic reticulum (hsa04141 )
Reactome Pathway
N-glycan trimming in the ER and Calnexin/Calreticulin cycle (R-HSA-532668 )
Calnexin/calreticulin cycle (R-HSA-901042 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
PNA-D-glucopyranoside DMPUC8I N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.90E-26 5.44E-01 1.33E+00
Alopecia ED70 Skin from scalp 1.60E-01 -5.64E-02 -3.56E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.22E-01 -2.19E-02 -1.03E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.64E-01 1.12E-01 6.71E-01
Aortic stenosis BB70 Calcified aortic valve 9.71E-01 2.38E-02 4.94E-02
Apnea 7A40 Hyperplastic tonsil 8.02E-02 -3.50E-01 -1.67E+00
Arthropathy FA00-FA5Z Peripheral blood 4.21E-01 -1.04E-01 -2.81E-01
Asthma CA23 Nasal and bronchial airway 1.05E-03 2.89E-01 3.47E-01
Atopic dermatitis EA80 Skin 1.10E-03 1.79E-01 3.44E-01
Autism 6A02 Whole blood 4.66E-01 1.31E-01 3.71E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.39E-01 1.99E-01 6.81E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.33E-01 -4.14E-01 -8.02E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.42E-23 6.36E-01 1.93E+00
Batten disease 5C56.1 Whole blood 5.53E-01 -1.88E-02 -3.94E-01
Behcet's disease 4A62 Peripheral blood 2.07E-01 -6.31E-02 -2.13E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.99E-01 -7.12E-02 -5.87E-01
Bladder cancer 2C94 Bladder tissue 2.97E-01 -1.31E-01 -5.94E-01
Breast cancer 2C60-2C6Z Breast tissue 4.48E-28 6.69E-01 7.51E-01
Cardioembolic stroke 8B11.20 Whole blood 2.97E-05 -2.70E-01 -1.50E+00
Cervical cancer 2C77 Cervical tissue 1.55E-05 3.76E-01 9.52E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.39E-01 1.13E-01 2.78E-01
Chronic hepatitis C 1E51.1 Whole blood 5.15E-01 2.51E-02 1.32E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.06E-02 -1.75E-01 -7.22E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.05E-01 8.97E-02 2.33E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.29E-02 3.35E-01 1.31E+00
Colon cancer 2B90 Colon tissue 1.61E-02 1.05E-01 2.99E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.54E-01 2.71E-01 1.29E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.88E-01 -1.66E-02 -9.11E-02
Endometriosis GA10 Endometrium tissue 2.25E-03 -1.82E-01 -8.61E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.48E-01 5.56E-02 1.71E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.48E-01 5.14E-02 2.04E-01
Gastric cancer 2B72 Gastric tissue 8.22E-01 -7.61E-03 -2.75E-02
Glioblastopma 2A00.00 Nervous tissue 9.89E-37 4.23E-01 8.03E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.52E-01 1.22E-01 1.09E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.40E-03 1.88E+00 1.73E+00
Head and neck cancer 2D42 Head and neck tissue 5.63E-10 3.52E-01 1.03E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.84E-02 -9.08E-02 -5.56E-01
Huntington's disease 8A01.10 Whole blood 3.12E-01 -1.03E-01 -9.91E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.58E-01 2.48E-01 1.06E+00
Immunodeficiency 4A00-4A20 Peripheral blood 5.06E-02 6.77E-02 4.32E-01
Influenza 1E30 Whole blood 7.46E-02 -1.67E-01 -9.99E-01
Interstitial cystitis GC00.3 Bladder tissue 8.44E-01 3.76E-02 1.17E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.57E-03 3.10E-01 6.85E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.21E-01 -3.12E-01 -6.39E-01
Ischemic stroke 8B11 Peripheral blood 6.01E-02 -1.22E-01 -9.18E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.27E-06 -2.46E-01 -8.03E-01
Lateral sclerosis 8B60.4 Skin 2.26E-01 -1.41E-01 -7.14E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.11E-01 -1.72E-01 -9.71E-01
Liver cancer 2C12.0 Liver tissue 1.41E-01 1.29E-01 1.55E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.61E-01 1.90E-01 4.28E-01
Lung cancer 2C25 Lung tissue 3.64E-01 1.11E-01 2.53E-01
Lupus erythematosus 4A40 Whole blood 2.58E-05 -1.76E-01 -4.12E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.82E-01 -3.73E-02 -3.03E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.00E-01 -6.90E-02 -1.88E-01
Melanoma 2C30 Skin 1.07E-01 4.01E-01 5.22E-01
Multiple myeloma 2A83.1 Peripheral blood 6.49E-01 4.75E-02 3.01E-01
Multiple myeloma 2A83.1 Bone marrow 1.76E-02 4.46E-01 1.25E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.16E-01 -7.89E-02 -2.47E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.43E-01 3.42E-02 8.24E-02
Myelofibrosis 2A20.2 Whole blood 5.59E-03 -5.30E-01 -3.01E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.68E-01 -9.09E-02 -1.85E-01
Myopathy 8C70.6 Muscle tissue 1.13E-04 2.86E-01 1.64E+00
Neonatal sepsis KA60 Whole blood 4.34E-01 -3.20E-02 -7.90E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.93E-02 2.48E-01 9.26E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.24E-01 -7.82E-02 -3.85E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.98E-03 -3.72E-01 -2.05E+00
Olive pollen allergy CA08.00 Peripheral blood 1.66E-01 4.43E-01 8.02E-01
Oral cancer 2B6E Oral tissue 1.69E-01 3.81E-01 6.40E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.97E-01 2.32E-01 1.76E-01
Osteoporosis FB83.1 Bone marrow 7.19E-03 3.94E-01 3.16E+00
Ovarian cancer 2C73 Ovarian tissue 1.26E-01 2.53E-01 2.69E-01
Pancreatic cancer 2C10 Pancreas 3.33E-04 1.92E+00 1.98E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.15E-01 4.88E-02 3.26E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.89E-01 -1.47E-01 -4.71E-01
Pituitary cancer 2D12 Pituitary tissue 9.53E-01 -1.45E-02 -1.02E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.83E-03 -1.52E-01 -1.35E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.35E-01 -4.44E-02 -3.59E-01
Polycythemia vera 2A20.4 Whole blood 1.20E-09 -2.52E-01 -1.19E+00
Pompe disease 5C51.3 Biceps muscle 1.54E-02 4.24E-01 3.08E+00
Preterm birth KA21.4Z Myometrium 7.22E-01 -2.47E-02 -8.67E-02
Prostate cancer 2C82 Prostate 1.91E-04 -6.39E-01 -1.19E+00
Psoriasis EA90 Skin 8.39E-05 -5.35E-01 -9.81E-01
Rectal cancer 2B92 Rectal colon tissue 9.17E-05 4.47E-01 3.45E+00
Renal cancer 2C90-2C91 Kidney 1.30E-01 6.40E-03 2.21E-02
Retinoblastoma 2D02.2 Uvea 9.32E-01 4.36E-02 2.62E-01
Rheumatoid arthritis FA20 Synovial tissue 2.38E-16 2.50E+00 1.55E+01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.35E-01 -2.30E-02 -1.75E-01
Schizophrenia 6A20 Prefrontal cortex 4.47E-01 1.35E-01 2.97E-01
Schizophrenia 6A20 Superior temporal cortex 2.35E-01 -2.01E-02 -3.20E-01
Scleroderma 4A42.Z Whole blood 8.19E-05 -2.50E-01 -1.74E+00
Seizure 8A60-8A6Z Whole blood 4.53E-02 -1.30E-01 -4.38E-01
Sensitive skin EK0Z Skin 7.33E-01 7.79E-02 3.36E-01
Sepsis with septic shock 1G41 Whole blood 2.16E-05 -2.29E-01 -6.72E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.92E-02 -3.30E-01 -1.73E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.20E-01 1.33E-01 5.17E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.77E-01 7.01E-02 3.97E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.53E-01 -6.75E-02 -1.99E-01
Skin cancer 2C30-2C3Z Skin 1.98E-03 1.92E-01 3.70E-01
Thrombocythemia 3B63 Whole blood 1.25E-03 -2.70E-01 -1.46E+00
Thrombocytopenia 3B64 Whole blood 8.57E-01 4.59E-02 6.65E-02
Thyroid cancer 2D10 Thyroid 5.86E-05 -1.80E-01 -4.23E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.19E-03 4.35E-01 1.37E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.72E-02 -2.84E-01 -2.77E+00
Type 2 diabetes 5A11 Liver tissue 9.12E-01 -6.95E-02 -3.38E-01
Ureter cancer 2C92 Urothelium 6.51E-01 -3.26E-02 -1.23E-01
Uterine cancer 2C78 Endometrium tissue 7.76E-11 -6.74E-01 -8.16E-01
Vitiligo ED63.0 Skin 1.09E-02 -1.40E-01 -1.11E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The heterodimeric structure of glucosidase II is required for its activity, solubility, and localization in vivo. Glycobiology. 2000 Aug;10(8):815-27.