Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DENCJTA)

DME Name Oxaloacetate decarboxylase (FAHD1)
Synonyms OAA decarboxylase; YisK-like protein; Mitochondrial acylpyruvase FAHD1; FAH domain-containing protein 1; Fumarylacetoacetate hydrolase domain-containing protein 1; YISKL; FAHD1; C16orf36
Gene Name FAHD1
UniProt ID
FAHD1_HUMAN
INTEDE ID
DME0542
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
81889
EC Number EC: 3.7.1.5
Hydrolases
Carbon-carbon hydrolase
Carbon-carbon hydrolase
EC: 3.7.1.5
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGIMAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPIL
MPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWT
LAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKII
TLEEGDIILTGTPKGVGPVKENDEIEAGIHGLVSMTFKVEKPEY
Function This enzyme hydrolyzes acetylpyruvate and fumarylpyruvate in vitro and also has oxaloacetate decarboxylase activity.
KEGG Pathway
Metabolic pathways (hsa01100 )
Tyrosine metabolism (hsa00350 )
Reactome Pathway
Citric acid cycle (TCA cycle) (R-HSA-71403 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
oxalacetic acid DMPZSV1 Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
oxalacetic acid Discovery agent [N.A.] Investigative Km = 0.032 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.60E-13 -5.61E-01 -9.32E-01
Alopecia ED70 Skin from scalp 4.27E-10 -3.76E-01 -1.63E+00
Alzheimer's disease 8A20 Entorhinal cortex 1.09E-08 -3.16E-01 -7.89E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.58E-02 3.96E-01 9.24E-01
Aortic stenosis BB70 Calcified aortic valve 8.82E-01 -3.95E-02 -3.87E-02
Apnea 7A40 Hyperplastic tonsil 4.35E-01 -6.05E-01 -1.10E+00
Arthropathy FA00-FA5Z Peripheral blood 6.91E-02 -1.65E-01 -5.72E-01
Asthma CA23 Nasal and bronchial airway 9.70E-06 2.24E-01 3.73E-01
Atopic dermatitis EA80 Skin 7.21E-01 5.44E-02 2.04E-01
Autism 6A02 Whole blood 8.04E-01 -1.37E-01 -3.32E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.88E-01 -1.21E-01 -2.37E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.00E-01 2.80E-02 7.61E-02
Bacterial infection of gingival 1C1H Gingival tissue 8.87E-18 -7.32E-01 -1.74E+00
Batten disease 5C56.1 Whole blood 3.57E-01 1.75E-02 1.04E-01
Behcet's disease 4A62 Peripheral blood 8.51E-02 2.65E-01 6.81E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.36E-01 -3.17E-02 -9.67E-02
Bladder cancer 2C94 Bladder tissue 6.84E-01 4.30E-03 1.10E-02
Breast cancer 2C60-2C6Z Breast tissue 4.47E-23 3.55E-01 7.19E-01
Cardioembolic stroke 8B11.20 Whole blood 2.94E-03 -4.65E-01 -1.47E+00
Cervical cancer 2C77 Cervical tissue 1.15E-02 -5.09E-01 -8.89E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.33E-01 -4.73E-02 -5.89E-02
Chronic hepatitis C 1E51.1 Whole blood 4.99E-02 1.56E-01 7.54E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.53E-03 -2.75E-01 -6.86E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.33E-01 7.93E-02 2.70E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.12E-01 2.50E-01 6.94E-01
Colon cancer 2B90 Colon tissue 3.56E-13 -3.11E-01 -6.03E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.24E-03 2.89E-01 1.37E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.46E-01 9.68E-02 2.43E-01
Endometriosis GA10 Endometrium tissue 9.97E-01 -3.43E-01 -3.34E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.25E-01 1.94E-01 7.97E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.49E-04 1.86E-01 5.70E-01
Gastric cancer 2B72 Gastric tissue 2.29E-01 1.20E+00 1.18E+00
Glioblastopma 2A00.00 Nervous tissue 9.77E-01 3.61E-02 5.42E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.36E-01 -2.00E-01 -9.44E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.51E-04 1.61E+00 2.09E+00
Head and neck cancer 2D42 Head and neck tissue 1.03E-01 1.68E-01 3.37E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.37E-01 -1.52E-01 -2.32E-01
Huntington's disease 8A01.10 Whole blood 1.09E-01 -2.57E-01 -5.93E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.07E-01 3.84E-01 9.06E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.81E-02 1.79E-01 1.75E+00
Influenza 1E30 Whole blood 2.29E-05 -2.10E+00 -1.79E+01
Interstitial cystitis GC00.3 Bladder tissue 3.47E-04 -7.03E-01 -3.31E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.29E-01 2.68E-01 5.38E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.38E-02 -1.63E-01 -4.17E-01
Ischemic stroke 8B11 Peripheral blood 9.05E-01 -2.28E-02 -5.84E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 2.40E-07 -1.61E-01 -4.59E-01
Lateral sclerosis 8B60.4 Skin 1.66E-01 1.61E-01 1.05E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 3.91E-01 -1.16E-01 -1.76E-01
Liver cancer 2C12.0 Liver tissue 1.97E-02 -6.71E-02 -1.13E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.93E-02 -7.07E-01 -1.41E+00
Lung cancer 2C25 Lung tissue 3.56E-14 3.18E-01 5.29E-01
Lupus erythematosus 4A40 Whole blood 4.92E-02 -6.19E-02 -1.38E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.11E-01 7.67E-03 2.52E-02
Major depressive disorder 6A70-6A7Z Whole blood 9.55E-01 -1.43E-02 -4.80E-02
Melanoma 2C30 Skin 5.57E-01 2.34E-01 5.21E-01
Multiple myeloma 2A83.1 Peripheral blood 5.79E-02 -4.00E-01 -1.54E+00
Multiple myeloma 2A83.1 Bone marrow 2.80E-07 8.40E-01 4.57E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.60E-01 1.34E-01 3.07E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.83E-03 2.08E-01 4.61E-01
Myelofibrosis 2A20.2 Whole blood 3.74E-03 9.10E-01 5.17E+00
Myocardial infarction BA41-BA50 Peripheral blood 5.10E-01 -2.80E-01 -3.13E-01
Myopathy 8C70.6 Muscle tissue 2.89E-01 -1.06E-01 -2.05E-01
Neonatal sepsis KA60 Whole blood 3.27E-01 -6.00E-02 -1.27E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.08E-06 1.89E+00 3.36E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.11E-01 -3.75E-01 -1.05E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.28E-02 -2.94E-01 -1.24E+00
Olive pollen allergy CA08.00 Peripheral blood 5.91E-01 -3.97E-01 -6.56E-01
Oral cancer 2B6E Oral tissue 7.87E-02 -4.24E-01 -6.89E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.05E-01 5.27E-02 1.21E-01
Osteoporosis FB83.1 Bone marrow 3.33E-01 -1.04E-01 -3.51E-01
Ovarian cancer 2C73 Ovarian tissue 6.99E-06 6.20E-01 2.63E+00
Pancreatic cancer 2C10 Pancreas 5.68E-02 2.83E-01 4.88E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.26E-01 -1.10E-01 -2.44E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.54E-01 9.39E-02 3.44E-01
Pituitary cancer 2D12 Pituitary tissue 7.37E-01 -1.95E-01 -2.46E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.85E-01 -3.51E-01 -4.57E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.67E-02 -1.36E-01 -7.13E-01
Polycythemia vera 2A20.4 Whole blood 2.76E-08 3.14E-01 1.83E+00
Pompe disease 5C51.3 Biceps muscle 2.06E-02 4.05E-01 1.42E+00
Preterm birth KA21.4Z Myometrium 6.82E-01 1.38E-01 7.95E-01
Prostate cancer 2C82 Prostate 9.14E-03 3.41E-01 6.77E-01
Psoriasis EA90 Skin 2.44E-02 1.05E-01 1.82E-01
Rectal cancer 2B92 Rectal colon tissue 2.32E-02 -3.52E-01 -1.12E+00
Renal cancer 2C90-2C91 Kidney 1.47E-01 3.80E-01 4.48E-01
Retinoblastoma 2D02.2 Uvea 3.07E-09 1.69E+00 5.17E+00
Rheumatoid arthritis FA20 Synovial tissue 3.10E-01 -1.04E-01 -1.73E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.31E-01 2.82E-02 9.73E-02
Schizophrenia 6A20 Prefrontal cortex 5.40E-02 -1.18E-01 -1.59E-01
Schizophrenia 6A20 Superior temporal cortex 7.33E-01 -1.84E-02 -6.04E-02
Scleroderma 4A42.Z Whole blood 3.82E-01 2.33E-01 6.45E-01
Seizure 8A60-8A6Z Whole blood 8.28E-01 8.72E-02 2.40E-01
Sensitive skin EK0Z Skin 8.83E-01 5.27E-02 2.77E-01
Sepsis with septic shock 1G41 Whole blood 1.09E-06 -3.86E-01 -7.54E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.57E-01 -3.21E-01 -8.09E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.70E-03 -1.39E-01 -9.74E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.86E-01 5.01E-02 2.70E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.43E-01 -1.75E-01 -4.07E-01
Skin cancer 2C30-2C3Z Skin 1.43E-01 -5.28E-02 -9.65E-02
Thrombocythemia 3B63 Whole blood 1.43E-03 1.29E-01 7.42E-01
Thrombocytopenia 3B64 Whole blood 8.26E-01 -8.92E-02 -1.74E-01
Thyroid cancer 2D10 Thyroid 1.46E-01 8.93E-02 1.92E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.89E-03 -2.65E-01 -1.40E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.51E-02 -2.72E-01 -2.37E+00
Type 2 diabetes 5A11 Liver tissue 5.56E-01 2.50E-02 7.51E-02
Ureter cancer 2C92 Urothelium 4.53E-01 1.21E-01 4.16E-01
Uterine cancer 2C78 Endometrium tissue 3.43E-02 -1.58E-01 -2.39E-01
Vitiligo ED63.0 Skin 5.04E-01 1.92E-01 7.57E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Identification of FAH domain-containing protein 1 (FAHD1) as oxaloacetate decarboxylase. J Biol Chem. 2015 Mar 13;290(11):6755-62.