General Information of Drug-Metabolizing Enzyme (DME) (ID: DENZF0O)

DME Name Cytosol aminopeptidase (LAP3)
Synonyms Leucine aminopeptidase 3; Leucyl aminopeptidase; Peptidase S; Proline aminopeptidase; Prolyl aminopeptidase; LAP-3; LAP3; LAPEP; PEPS
Gene Name LAP3
UniProt ID
AMPL_HUMAN
INTEDE ID
DME0569
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
51056
EC Number EC: 3.4.11.1
Hydrolases
Peptidase
Aminopeptidase
EC: 3.4.11.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFD
KLLAGKLRETLNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGS
GDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWI
EEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMD
LMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
Function This enzyme catalyzes the removal of unsubstituted N- terminal amino acids from various peptides.
KEGG Pathway
Arginine and proline metabolism (hsa00330 )
Glutathione metabolism (hsa00480 )
Metabolic pathways (hsa01100 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dynorphin a DMT2WVP N. A. N. A. Discontinued in Phase 2 [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.15E-18 5.52E-01 9.64E-01
Alopecia ED70 Skin from scalp 1.63E-12 -8.75E-01 -1.93E+00
Alzheimer's disease 8A20 Entorhinal cortex 3.96E-02 1.55E-01 4.12E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.25E-01 -2.46E-01 -7.00E-01
Aortic stenosis BB70 Calcified aortic valve 8.10E-01 -1.10E-01 -5.55E-02
Apnea 7A40 Hyperplastic tonsil 9.53E-02 3.14E-01 3.30E-01
Arthropathy FA00-FA5Z Peripheral blood 8.88E-01 -1.62E-02 -3.05E-02
Asthma CA23 Nasal and bronchial airway 2.36E-05 3.97E-01 3.87E-01
Atopic dermatitis EA80 Skin 9.43E-02 -1.88E-01 -9.71E-01
Autism 6A02 Whole blood 2.26E-01 -2.24E-01 -2.63E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.43E-01 -2.50E-01 -7.06E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.13E-01 1.26E+00 8.18E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.71E-01 5.00E-02 1.13E-01
Batten disease 5C56.1 Whole blood 6.11E-01 1.73E-03 3.01E-03
Behcet's disease 4A62 Peripheral blood 9.79E-02 2.98E-01 1.14E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.00E-01 -5.32E-02 -2.07E-01
Bladder cancer 2C94 Bladder tissue 5.86E-03 -3.51E-01 -1.45E+00
Breast cancer 2C60-2C6Z Breast tissue 6.89E-22 3.78E-01 6.56E-01
Cardioembolic stroke 8B11.20 Whole blood 9.68E-01 -4.51E-02 -1.21E-01
Cervical cancer 2C77 Cervical tissue 3.28E-06 6.99E-01 1.54E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.67E-01 6.75E-02 6.27E-02
Chronic hepatitis C 1E51.1 Whole blood 3.29E-01 2.44E-01 4.53E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.07E-01 4.60E-03 1.07E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.12E-02 1.40E-01 3.50E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.67E-01 2.96E-01 5.12E-01
Colon cancer 2B90 Colon tissue 3.31E-11 2.14E-01 6.57E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.84E-01 -2.48E-01 -2.08E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.47E-01 9.51E-02 2.38E-01
Endometriosis GA10 Endometrium tissue 9.13E-01 -1.41E-01 -2.13E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.23E-01 -1.76E-01 -4.41E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.68E-06 1.33E+00 1.34E+00
Gastric cancer 2B72 Gastric tissue 2.49E-01 9.35E-01 8.47E-01
Glioblastopma 2A00.00 Nervous tissue 1.05E-173 1.30E+00 2.53E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.00E-01 -8.70E-01 -2.25E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.83E-02 4.48E-01 6.62E-01
Head and neck cancer 2D42 Head and neck tissue 1.70E-08 5.99E-01 8.80E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.09E-01 3.75E-01 7.53E-01
Huntington's disease 8A01.10 Whole blood 6.00E-01 2.43E-02 3.32E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.33E-01 1.42E-01 2.72E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.24E-06 1.10E+00 8.67E+00
Influenza 1E30 Whole blood 2.90E-01 7.00E-01 8.61E-01
Interstitial cystitis GC00.3 Bladder tissue 4.04E-05 1.13E+00 7.56E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.61E-04 4.50E-01 8.95E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.60E-02 -4.38E-01 -9.40E-01
Ischemic stroke 8B11 Peripheral blood 3.47E-01 -1.90E-01 -4.58E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.18E-05 -3.86E-01 -5.10E-01
Lateral sclerosis 8B60.4 Skin 2.24E-02 2.74E-01 2.33E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 1.97E-01 -5.42E-01 -6.38E-01
Liver cancer 2C12.0 Liver tissue 4.95E-13 -7.09E-01 -1.52E+00
Liver failure DB99.7-DB99.8 Liver tissue 5.62E-02 -1.97E-01 -3.43E-01
Lung cancer 2C25 Lung tissue 6.22E-15 -2.45E-01 -6.09E-01
Lupus erythematosus 4A40 Whole blood 4.86E-09 9.89E-01 1.01E+00
Major depressive disorder 6A70-6A7Z Hippocampus 2.93E-01 -1.19E-01 -4.61E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.38E-01 -7.52E-02 -1.51E-01
Melanoma 2C30 Skin 4.93E-04 4.79E-01 1.04E+00
Multiple myeloma 2A83.1 Peripheral blood 4.33E-01 -7.17E-02 -1.08E-01
Multiple myeloma 2A83.1 Bone marrow 1.43E-05 2.01E+00 4.11E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.32E-01 3.24E-01 7.13E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.48E-01 5.31E-02 1.19E-01
Myelofibrosis 2A20.2 Whole blood 5.38E-01 -2.58E-02 -4.00E-02
Myocardial infarction BA41-BA50 Peripheral blood 1.17E-01 2.29E-01 2.67E-01
Myopathy 8C70.6 Muscle tissue 1.13E-04 8.29E-01 2.55E+00
Neonatal sepsis KA60 Whole blood 2.91E-01 1.61E-01 2.52E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.71E-03 6.18E-01 1.33E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.01E-01 3.37E-01 5.44E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.61E-02 -2.02E-01 -6.74E-01
Olive pollen allergy CA08.00 Peripheral blood 9.55E-01 -3.34E-01 -5.93E-01
Oral cancer 2B6E Oral tissue 4.13E-10 1.48E+00 1.99E+00
Osteoarthritis FA00-FA0Z Synovial tissue 8.24E-01 2.65E-02 7.34E-02
Osteoporosis FB83.1 Bone marrow 1.25E-01 -4.74E-01 -5.74E-01
Ovarian cancer 2C73 Ovarian tissue 1.02E-04 1.17E+00 2.13E+00
Pancreatic cancer 2C10 Pancreas 1.38E-02 8.13E-01 9.43E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.79E-01 1.23E-01 2.14E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.32E-05 1.35E+00 1.96E+00
Pituitary cancer 2D12 Pituitary tissue 7.94E-01 -2.61E-01 -3.18E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.10E-02 -4.30E-01 -7.82E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.44E-01 3.30E-02 1.40E-01
Polycythemia vera 2A20.4 Whole blood 4.55E-02 4.28E-01 6.40E-01
Pompe disease 5C51.3 Biceps muscle 4.96E-01 1.96E-01 5.18E-01
Preterm birth KA21.4Z Myometrium 6.59E-01 -4.09E-02 -7.66E-02
Prostate cancer 2C82 Prostate 9.98E-01 2.03E-01 2.62E-01
Psoriasis EA90 Skin 3.50E-14 3.57E-01 1.14E+00
Rectal cancer 2B92 Rectal colon tissue 1.86E-02 2.08E-01 1.23E+00
Renal cancer 2C90-2C91 Kidney 5.57E-02 7.67E-01 8.68E-01
Retinoblastoma 2D02.2 Uvea 2.24E-05 1.25E+00 4.35E+00
Rheumatoid arthritis FA20 Synovial tissue 2.79E-03 8.57E-01 1.41E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.84E-02 4.60E-02 1.22E-01
Schizophrenia 6A20 Prefrontal cortex 1.41E-01 6.91E-02 7.55E-02
Schizophrenia 6A20 Superior temporal cortex 2.32E-01 1.41E-01 4.18E-01
Scleroderma 4A42.Z Whole blood 8.25E-04 5.76E-01 1.80E+00
Seizure 8A60-8A6Z Whole blood 5.66E-01 8.58E-01 8.05E-01
Sensitive skin EK0Z Skin 5.18E-01 1.83E-01 6.07E-01
Sepsis with septic shock 1G41 Whole blood 8.15E-01 -7.56E-02 -1.04E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.09E-01 -1.73E-01 -4.15E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.17E-01 2.87E-02 3.23E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 4.63E-01 -4.02E-02 -1.74E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.27E-02 4.94E-01 1.49E+00
Skin cancer 2C30-2C3Z Skin 3.43E-14 3.79E-01 1.13E+00
Thrombocythemia 3B63 Whole blood 5.81E-01 -3.12E-02 -4.84E-02
Thrombocytopenia 3B64 Whole blood 5.76E-01 -5.84E-01 -1.25E+00
Thyroid cancer 2D10 Thyroid 1.16E-01 2.21E-01 3.70E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.76E-03 2.18E-01 8.84E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.00E-01 2.98E-01 4.04E+00
Type 2 diabetes 5A11 Liver tissue 4.11E-01 6.19E-02 1.80E-01
Ureter cancer 2C92 Urothelium 3.00E-01 -2.87E-01 -2.48E-01
Uterine cancer 2C78 Endometrium tissue 2.02E-11 5.97E-01 8.09E-01
Vitiligo ED63.0 Skin 2.20E-01 5.08E-02 4.72E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Human brain leucyl aminopeptidase: isolation, characterization and specificity against some neuropeptides. Neuropeptides. 1991 Jul;19(3):163-8.