General Information of Drug-Metabolizing Enzyme (DME) (ID: DENZGO4)

DME Name ADP-dependent glucokinase (ADPGK)
Synonyms ADP-specific glucokinase; Glucokinase ADP dependent; ADP-GK; ADPGK; PSEC0260; RbBP-35; 2610017G09Rik
Gene Name ADPGK
UniProt ID
ADPGK_HUMAN
INTEDE ID
DME0475
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
83440
EC Number EC: 2.7.1.147
Transferase
Kinase
Phosphotransferase
EC: 2.7.1.147
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MALWRGSAYAGFLALAVGCVFLLEPELPGSALRSLWSSLCLGPAPAPPGPVSPEGRLAAA
WDALIVRPVRRWRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFI
HFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLCGP
VGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAM
NMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELAS
MTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILF
WILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETI
DTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLG
DAISAEGLFYSEVHPHY
Function This enzyme catalyzes the phosphorylation of D-glucose to D-glucose 6- phosphate using ADP as the phosphate donor.
KEGG Pathway
Carbon metabolism (hsa01200 )
Glycolysis / Gluconeogenesis (hsa00010 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Glycolysis (R-HSA-70171 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-glucose DMMG2TO Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
D-glucose Discovery agent [N.A.] Investigative Km = 0.27 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.49E-07 1.86E-01 5.42E-01
Alopecia ED70 Skin from scalp 7.65E-01 -4.62E-02 -1.44E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.34E-01 -5.24E-02 -2.91E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.34E-01 7.18E-02 1.94E-01
Aortic stenosis BB70 Calcified aortic valve 2.71E-01 3.84E-02 1.07E-01
Apnea 7A40 Hyperplastic tonsil 3.31E-01 1.84E-01 8.28E-01
Arthropathy FA00-FA5Z Peripheral blood 6.07E-01 6.53E-02 3.94E-01
Asthma CA23 Nasal and bronchial airway 1.88E-03 8.65E-02 1.59E-01
Atopic dermatitis EA80 Skin 1.40E-04 1.66E-01 7.46E-01
Autism 6A02 Whole blood 6.29E-01 4.64E-02 1.01E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.58E-01 -2.46E-01 -4.65E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.27E-01 -1.39E-02 -5.02E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.50E-13 4.30E-01 1.68E+00
Batten disease 5C56.1 Whole blood 4.45E-01 1.06E-01 5.84E-01
Behcet's disease 4A62 Peripheral blood 5.32E-01 -9.02E-02 -5.12E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.96E-02 -1.24E-01 -1.26E+00
Bladder cancer 2C94 Bladder tissue 8.42E-02 1.23E-01 1.03E+00
Breast cancer 2C60-2C6Z Breast tissue 4.93E-70 6.21E-01 1.68E+00
Cardioembolic stroke 8B11.20 Whole blood 1.06E-05 -1.58E-01 -1.32E+00
Cervical cancer 2C77 Cervical tissue 4.56E-06 1.27E-01 8.39E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.46E-01 -3.20E-02 -1.82E-01
Chronic hepatitis C 1E51.1 Whole blood 3.61E-01 -1.12E-02 -1.06E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.69E-01 2.46E-02 9.08E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.78E-03 -1.73E-01 -6.57E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.58E-02 1.25E-01 1.27E+00
Colon cancer 2B90 Colon tissue 1.04E-07 1.28E-01 4.87E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.93E-01 -1.56E-01 -5.25E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.28E-01 2.34E-01 7.54E-01
Endometriosis GA10 Endometrium tissue 4.05E-01 -7.32E-02 -1.61E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.81E-02 -1.68E-01 -1.54E+00
Familial hypercholesterolemia 5C80.00 Whole blood 1.41E-03 3.88E-01 1.00E+00
Gastric cancer 2B72 Gastric tissue 6.57E-01 2.15E-01 5.25E-01
Glioblastopma 2A00.00 Nervous tissue 2.91E-46 2.60E-01 7.92E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.84E-01 -1.04E-01 -2.14E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.71E-02 7.26E-01 8.85E-01
Head and neck cancer 2D42 Head and neck tissue 6.68E-04 5.37E-02 1.07E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.04E-01 -6.76E-02 -4.29E-01
Huntington's disease 8A01.10 Whole blood 1.90E-01 2.42E-01 6.44E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.65E-01 -1.09E-01 -7.38E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.70E-03 -2.91E-01 -1.37E+00
Influenza 1E30 Whole blood 9.37E-02 -2.54E-01 -1.14E+00
Interstitial cystitis GC00.3 Bladder tissue 1.51E-04 5.61E-01 5.55E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.67E-04 6.70E-01 3.10E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.34E-01 3.94E-02 1.79E-01
Ischemic stroke 8B11 Peripheral blood 1.33E-01 -1.40E-01 -6.18E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.25E-01 -4.82E-02 -1.79E-01
Lateral sclerosis 8B60.4 Skin 3.04E-01 9.00E-02 8.47E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.71E-01 -1.28E-01 -4.49E-01
Liver cancer 2C12.0 Liver tissue 2.61E-04 3.38E-01 8.64E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.21E-04 3.46E-01 2.07E+00
Lung cancer 2C25 Lung tissue 1.08E-03 -9.04E-02 -2.45E-01
Lupus erythematosus 4A40 Whole blood 3.19E-05 4.03E-01 6.89E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.55E-01 -2.15E-02 -2.15E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.36E-01 8.06E-02 3.17E-01
Melanoma 2C30 Skin 4.07E-04 5.84E-01 1.20E+00
Multiple myeloma 2A83.1 Peripheral blood 5.92E-02 7.78E-02 4.45E-01
Multiple myeloma 2A83.1 Bone marrow 4.28E-02 1.57E-01 7.25E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.03E-01 -1.36E-01 -7.07E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.00E-03 -9.02E-02 -2.78E-01
Myelofibrosis 2A20.2 Whole blood 5.51E-08 -4.61E-01 -3.37E+00
Myocardial infarction BA41-BA50 Peripheral blood 7.99E-01 3.57E-04 6.90E-04
Myopathy 8C70.6 Muscle tissue 8.62E-03 4.06E-01 1.56E+00
Neonatal sepsis KA60 Whole blood 2.42E-10 2.75E-01 7.25E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.09E-01 1.85E-01 7.24E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.56E-02 1.62E-01 2.50E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.96E-01 -1.99E-01 -8.02E-01
Olive pollen allergy CA08.00 Peripheral blood 7.40E-01 1.93E-02 7.54E-02
Oral cancer 2B6E Oral tissue 3.02E-07 4.58E-01 1.39E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.48E-01 4.40E-01 4.56E-01
Osteoporosis FB83.1 Bone marrow 7.60E-01 -1.28E-01 -4.46E-01
Ovarian cancer 2C73 Ovarian tissue 9.94E-04 6.92E-01 1.95E+00
Pancreatic cancer 2C10 Pancreas 1.03E-02 5.66E-01 9.02E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.53E-01 -2.07E-01 -6.28E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.69E-01 6.60E-02 3.59E-01
Pituitary cancer 2D12 Pituitary tissue 5.63E-01 -1.30E-01 -5.01E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.13E-02 -2.63E-01 -9.23E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.88E-01 1.21E-03 1.07E-02
Polycythemia vera 2A20.4 Whole blood 1.96E-22 -3.76E-01 -2.39E+00
Pompe disease 5C51.3 Biceps muscle 7.85E-01 -4.28E-02 -2.11E-01
Preterm birth KA21.4Z Myometrium 4.99E-01 -4.78E-01 -8.43E-01
Prostate cancer 2C82 Prostate 6.22E-01 2.13E-01 3.91E-01
Psoriasis EA90 Skin 1.32E-10 2.43E-01 8.61E-01
Rectal cancer 2B92 Rectal colon tissue 3.11E-02 3.07E-01 1.10E+00
Renal cancer 2C90-2C91 Kidney 9.88E-05 6.70E-01 2.07E+00
Retinoblastoma 2D02.2 Uvea 8.75E-11 1.51E+00 8.12E+00
Rheumatoid arthritis FA20 Synovial tissue 1.00E-05 1.66E+00 4.66E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.88E-02 1.69E-02 1.45E-01
Schizophrenia 6A20 Prefrontal cortex 2.62E-01 -2.36E-02 -2.76E-02
Schizophrenia 6A20 Superior temporal cortex 7.16E-01 2.06E-02 2.60E-01
Scleroderma 4A42.Z Whole blood 1.06E-06 2.05E-01 2.75E+00
Seizure 8A60-8A6Z Whole blood 7.23E-01 -1.03E-01 -3.25E-01
Sensitive skin EK0Z Skin 2.71E-01 2.34E-01 1.77E+00
Sepsis with septic shock 1G41 Whole blood 1.68E-01 2.43E-02 6.31E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.07E-02 -3.56E-01 -1.50E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.13E-03 -4.41E-01 -1.62E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.47E-01 -8.47E-02 -3.91E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.60E-02 -1.43E-01 -1.02E+00
Skin cancer 2C30-2C3Z Skin 6.22E-37 5.41E-01 1.79E+00
Thrombocythemia 3B63 Whole blood 2.36E-15 -2.94E-01 -2.16E+00
Thrombocytopenia 3B64 Whole blood 8.64E-01 1.87E-02 5.02E-02
Thyroid cancer 2D10 Thyroid 2.35E-06 2.40E-01 8.27E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.29E-11 8.31E-01 4.26E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.01E-02 -3.61E-01 -1.68E+00
Type 2 diabetes 5A11 Liver tissue 5.27E-01 -1.50E-01 -5.52E-01
Ureter cancer 2C92 Urothelium 1.86E-01 -1.53E-01 -7.03E-01
Uterine cancer 2C78 Endometrium tissue 5.86E-02 -2.08E-01 -5.01E-01
Vitiligo ED63.0 Skin 1.71E-01 8.37E-02 8.24E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The Structural and functional characterization of mammalian ADP-dependent glucokinase. J Biol Chem. 2016 Feb 19;291(8):3694-704.