Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEOH5V3)

DME Name Spermine oxidase (SMOX)
Synonyms Polyamine oxidase 1; SMO; SMOX; PAO-1; PAOh1; C20orf16; UNQ3039/PRO9854
Gene Name SMOX
UniProt ID
SMOX_HUMAN
INTEDE ID
DME0590
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
54498
EC Number EC: 1.5.3.16
Oxidoreductase
CH-NH donor oxidoreductase
Oxygen acceptor oxidoreductase
EC: 1.5.3.16
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSHI
GGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNHGRRIPKDVVEEFSDLYNEVYNLTQEFFRHDKPVNAESQNSVGVFTREEVRNRI
RNDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAEGIPAHVIQLGKPVRCIHWDQASARPRGPEIEPRGEGDHNHDTGEGGQGGEEP
RGGRWDEDEQWSVVVECEDCELIPADHVIVTVSLGVLKRQYTSFFRPGLPTEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESHTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRG
SYSYTQVGSSGADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGALLSGQREA
ARLIEMYRDLFQQGT
Function
This enzyme catalyzes the oxidation of spermine to spermidine. It can also use N(1)-acetylspermine and spermidine as substrates, with different affinity depending on the isoform (isozyme) and on the experimental conditions.
KEGG Pathway
Arginine and proline metabolism (hsa00330 )
Metabolic pathways (hsa01100 )
beta-Alanine metabolism (hsa00410 )
Reactome Pathway
PAOs oxidise polyamines to amines [Q9NWM0-3] (R-HSA-141334 )
Interconversion of polyamines [Q9NWM0-3] (R-HSA-351200 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
SPERMINE DMD4BFY N. A. N. A. Terminated [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.01E-07 1.62E-01 3.44E-01
Alopecia ED70 Skin from scalp 9.39E-01 1.61E-01 2.82E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.08E-05 1.59E-01 5.83E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.81E-01 1.77E-01 1.21E+00
Aortic stenosis BB70 Calcified aortic valve 7.89E-01 1.13E-01 3.00E-01
Apnea 7A40 Hyperplastic tonsil 2.08E-01 -1.79E-01 -5.83E-01
Arthropathy FA00-FA5Z Peripheral blood 1.10E-01 3.10E-01 9.26E-01
Asthma CA23 Nasal and bronchial airway 4.01E-01 3.11E-03 9.07E-03
Atopic dermatitis EA80 Skin 1.02E-02 -1.93E-01 -8.27E-01
Autism 6A02 Whole blood 8.84E-01 6.00E-02 2.11E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.35E-02 -4.33E-01 -3.52E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.34E-01 7.54E-02 6.76E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.93E-02 1.08E-01 3.63E-01
Batten disease 5C56.1 Whole blood 6.40E-01 -5.72E-02 -1.45E-01
Behcet's disease 4A62 Peripheral blood 2.87E-01 1.89E-02 7.12E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.48E-01 6.65E-02 3.77E-01
Bladder cancer 2C94 Bladder tissue 7.92E-04 5.84E-01 2.76E+00
Breast cancer 2C60-2C6Z Breast tissue 1.04E-02 -6.80E-02 -2.31E-01
Cardioembolic stroke 8B11.20 Whole blood 7.92E-01 -1.97E-01 -4.50E-01
Cervical cancer 2C77 Cervical tissue 3.73E-02 1.80E-01 6.72E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.49E-02 1.27E-01 5.07E-01
Chronic hepatitis C 1E51.1 Whole blood 5.91E-02 6.81E-02 1.04E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 5.56E-01 -5.77E-02 -2.99E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.11E-01 6.30E-02 2.33E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.76E-02 2.09E-01 1.90E+00
Colon cancer 2B90 Colon tissue 1.65E-06 -1.49E-01 -4.42E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.23E-01 -1.71E-01 -3.91E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.24E-02 -1.73E-01 -1.48E+00
Endometriosis GA10 Endometrium tissue 1.00E+00 1.09E-01 1.91E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.74E-01 5.69E-02 2.92E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.92E-01 1.59E-01 5.37E-01
Gastric cancer 2B72 Gastric tissue 2.16E-01 -1.02E+00 -1.67E+00
Glioblastopma 2A00.00 Nervous tissue 5.77E-14 -3.02E-01 -6.23E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.75E-03 -1.77E-01 -4.16E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.70E-01 -1.44E-03 -6.84E-03
Head and neck cancer 2D42 Head and neck tissue 3.57E-01 3.60E-02 1.38E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.76E-01 -1.27E-01 -3.53E-01
Huntington's disease 8A01.10 Whole blood 2.18E-01 -1.12E-02 -6.68E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.65E-01 3.20E-02 2.01E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.09E-01 -5.08E-02 -4.52E-01
Influenza 1E30 Whole blood 4.50E-01 3.10E-01 6.06E-01
Interstitial cystitis GC00.3 Bladder tissue 7.98E-01 5.56E-04 3.78E-03
Intracranial aneurysm 8B01.0 Intracranial artery 4.69E-01 -1.87E-01 -5.87E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.85E-02 -2.62E-02 -9.64E-02
Ischemic stroke 8B11 Peripheral blood 1.31E-01 3.66E-02 1.97E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.11E-04 2.03E-01 3.84E-01
Lateral sclerosis 8B60.4 Skin 8.73E-01 -6.11E-02 -3.23E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.59E-01 3.05E-02 8.26E-02
Liver cancer 2C12.0 Liver tissue 9.63E-05 -1.75E-01 -4.92E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.13E-01 -3.57E-02 -1.58E-01
Lung cancer 2C25 Lung tissue 6.26E-01 1.56E-02 6.42E-02
Lupus erythematosus 4A40 Whole blood 3.81E-01 -1.60E-01 -3.24E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.35E-01 -1.01E-02 -6.07E-02
Major depressive disorder 6A70-6A7Z Whole blood 1.92E-01 1.88E-02 6.23E-02
Melanoma 2C30 Skin 7.07E-01 3.61E-02 5.60E-02
Multiple myeloma 2A83.1 Peripheral blood 8.11E-01 -7.42E-04 -3.58E-03
Multiple myeloma 2A83.1 Bone marrow 6.56E-01 -2.37E-02 -7.51E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.95E-02 2.63E-01 9.77E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.14E-01 -4.63E-02 -1.78E-01
Myelofibrosis 2A20.2 Whole blood 5.18E-02 8.36E-02 5.40E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.59E-01 4.05E-01 6.57E-01
Myopathy 8C70.6 Muscle tissue 1.54E-01 -6.97E-02 -4.94E-01
Neonatal sepsis KA60 Whole blood 1.91E-06 2.52E-01 5.65E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.47E-06 -1.58E+00 -3.37E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.02E-01 -9.25E-02 -4.97E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.83E-01 -5.60E-02 -3.28E-01
Olive pollen allergy CA08.00 Peripheral blood 3.67E-01 1.81E-02 5.18E-02
Oral cancer 2B6E Oral tissue 2.36E-03 -2.50E-01 -5.17E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.93E-02 -5.00E-01 -1.13E+00
Osteoporosis FB83.1 Bone marrow 1.17E-01 6.61E-01 1.09E+00
Ovarian cancer 2C73 Ovarian tissue 5.59E-01 1.85E-02 3.83E-02
Pancreatic cancer 2C10 Pancreas 1.92E-04 -3.67E-01 -1.10E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 9.11E-01 -3.00E-02 -1.39E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.53E-03 1.08E-01 4.85E-01
Pituitary cancer 2D12 Pituitary tissue 5.75E-02 2.66E-01 8.65E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.88E-01 9.09E-03 3.14E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.44E-02 -1.29E-01 -8.61E-01
Polycythemia vera 2A20.4 Whole blood 7.25E-01 1.25E-02 8.00E-02
Pompe disease 5C51.3 Biceps muscle 2.15E-01 -1.23E-01 -1.21E+00
Preterm birth KA21.4Z Myometrium 2.11E-01 -2.42E-01 -4.18E-01
Prostate cancer 2C82 Prostate 5.55E-01 -4.40E-01 -6.93E-01
Psoriasis EA90 Skin 4.79E-01 5.40E-02 1.16E-01
Rectal cancer 2B92 Rectal colon tissue 7.44E-01 2.27E-02 6.86E-02
Renal cancer 2C90-2C91 Kidney 2.77E-02 -2.32E-01 -6.02E-01
Retinoblastoma 2D02.2 Uvea 7.44E-03 -3.18E-01 -2.86E+00
Rheumatoid arthritis FA20 Synovial tissue 1.69E-02 -7.68E-01 -1.44E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.88E-01 -1.06E-02 -8.20E-02
Schizophrenia 6A20 Prefrontal cortex 4.50E-01 2.75E-02 8.64E-02
Schizophrenia 6A20 Superior temporal cortex 8.81E-01 2.92E-02 1.08E-01
Scleroderma 4A42.Z Whole blood 3.69E-04 -5.53E-01 -1.79E+00
Seizure 8A60-8A6Z Whole blood 1.83E-01 -1.41E-01 -4.01E-01
Sensitive skin EK0Z Skin 4.13E-01 1.18E-01 4.13E-01
Sepsis with septic shock 1G41 Whole blood 1.07E-05 1.19E-01 2.70E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.73E-02 3.71E-01 1.10E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.65E-01 2.01E-01 2.41E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.58E-01 3.92E-03 1.53E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.98E-01 3.90E-01 8.71E-01
Skin cancer 2C30-2C3Z Skin 1.30E-04 -3.01E-01 -6.21E-01
Thrombocythemia 3B63 Whole blood 2.22E-01 2.01E-02 1.35E-01
Thrombocytopenia 3B64 Whole blood 7.17E-01 -1.17E-01 -3.10E-01
Thyroid cancer 2D10 Thyroid 1.72E-05 9.25E-02 4.09E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.34E-01 -6.54E-02 -2.98E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.85E-01 7.90E-02 5.35E-01
Type 2 diabetes 5A11 Liver tissue 6.23E-02 -2.58E-01 -1.51E+00
Ureter cancer 2C92 Urothelium 5.45E-02 4.63E-02 4.31E-01
Uterine cancer 2C78 Endometrium tissue 1.05E-02 1.13E-01 3.19E-01
Vitiligo ED63.0 Skin 8.18E-01 6.38E-02 2.07E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Distinct immunomodulatory effects of spermine oxidase in colitis induced by epithelial injury or infection. Front Immunol. 2018 Jun 5;9:1242.