Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEOT0QC)

DME Name Methylarsonite methyltransferase N6AMT1 (N6AMT1)
Synonyms Methyltransferase N6AMT1; N(6)-adenine-specific DNA methyltransferase 1; N(5)-glutamine methyltransferase; HemK methyltransferase family member 2; M.HsaHemK2P; C21orf127; HEMK2; N6AMT1; PRED28
Gene Name N6AMT1
UniProt ID
N6MT1_HUMAN
INTEDE ID
DME0426
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
29104
EC Number EC: 2.1.1.72
Transferase
Methylase
Methyltransferase
EC: 2.1.1.72
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVS
AFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLV
FNPPYVVTPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPE
EILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Function
This enzyme can methylate both proteins and DNA, and to a lower extent, arsenic. Its catalytic subunit of a heterodimer with TRMT112, which catalyzes N5-methylation of Glu residue of proteins with a Gly- Gln-Xaa-Xaa-Xaa-Arg motif. It also methylates ETF1 on 'Gln-185' and acts as a N(6)-adenine-specific DNA methyltransferase by mediating methylation of DNA on the 6th position of adenine (N(6)- methyladenosine). It may also play a role in the modulation of arsenic-induced toxicity by mediating the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid. It however only plays a limited role in arsenic metabolism compared with AS3MT.
Reactome Pathway
Methylation (R-HSA-156581 )
Eukaryotic Translation Termination (R-HSA-72764 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Arsenic DMTL2Y1 N. A. N. A. Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.93E-11 -2.05E-01 -8.30E-01
Alopecia ED70 Skin from scalp 2.07E-03 2.52E-01 7.16E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.79E-02 -4.94E-02 -2.89E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.21E-01 3.97E-02 3.46E-01
Aortic stenosis BB70 Calcified aortic valve 7.49E-01 -7.90E-02 -1.29E-01
Apnea 7A40 Hyperplastic tonsil 7.78E-01 6.97E-03 5.34E-02
Arthropathy FA00-FA5Z Peripheral blood 8.93E-02 -4.66E-02 -3.53E-01
Asthma CA23 Nasal and bronchial airway 1.55E-02 -1.80E-01 -1.42E-01
Atopic dermatitis EA80 Skin 9.86E-02 -3.07E-02 -1.73E-01
Autism 6A02 Whole blood 4.49E-01 4.67E-02 2.67E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.14E-01 -5.21E-02 -3.71E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.61E-01 0.00E+00 0.00E+00
Bacterial infection of gingival 1C1H Gingival tissue 5.24E-02 4.12E-02 1.29E-01
Batten disease 5C56.1 Whole blood 2.63E-01 -1.55E-03 -7.78E-03
Behcet's disease 4A62 Peripheral blood 4.79E-01 4.66E-02 6.15E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.31E-01 -1.91E-02 -1.01E-01
Bladder cancer 2C94 Bladder tissue 2.02E-03 2.37E-01 3.14E+00
Breast cancer 2C60-2C6Z Breast tissue 1.45E-07 -5.71E-02 -1.19E-01
Cardioembolic stroke 8B11.20 Whole blood 3.14E-01 -6.47E-02 -1.35E-01
Cervical cancer 2C77 Cervical tissue 7.41E-01 7.09E-02 2.32E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.00E-01 -2.16E-02 -6.08E-02
Chronic hepatitis C 1E51.1 Whole blood 7.45E-01 -1.16E-02 -6.45E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 3.22E-01 5.85E-02 2.26E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.54E-01 6.21E-02 2.78E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.33E-01 -2.67E-02 -1.91E-01
Colon cancer 2B90 Colon tissue 1.36E-03 -9.99E-02 -3.69E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.81E-02 -1.74E-01 -1.80E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.69E-01 -5.42E-02 -4.80E-01
Endometriosis GA10 Endometrium tissue 3.83E-04 -2.43E-01 -9.85E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.95E-02 -1.01E-01 -5.52E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.36E-01 -6.10E-02 -4.16E-01
Gastric cancer 2B72 Gastric tissue 7.46E-02 -6.13E-01 -2.31E+00
Glioblastopma 2A00.00 Nervous tissue 1.01E-23 -2.49E-01 -9.21E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.78E-01 2.00E-02 3.09E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.24E-01 -1.34E-01 -2.83E-01
Head and neck cancer 2D42 Head and neck tissue 6.48E-01 -3.05E-03 -1.46E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.61E-02 -5.61E-02 -3.22E-01
Huntington's disease 8A01.10 Whole blood 1.33E-01 -6.92E-02 -3.12E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.49E-01 -2.63E-02 -1.07E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.66E-01 -2.34E-02 -2.30E-01
Influenza 1E30 Whole blood 7.14E-03 -3.83E-01 -2.99E+00
Interstitial cystitis GC00.3 Bladder tissue 5.94E-01 -9.81E-02 -4.44E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.98E-01 1.76E-02 8.20E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.61E-01 -8.64E-02 -2.49E-01
Ischemic stroke 8B11 Peripheral blood 3.40E-01 7.96E-02 8.17E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.73E-01 -2.28E-01 -3.81E-01
Lateral sclerosis 8B60.4 Skin 7.09E-01 -3.78E-02 -1.64E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.47E-01 9.32E-02 3.36E-01
Liver cancer 2C12.0 Liver tissue 8.94E-04 -1.59E-01 -6.59E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.92E-01 -1.08E-01 -4.34E-01
Lung cancer 2C25 Lung tissue 4.30E-03 -3.98E-02 -1.50E-01
Lupus erythematosus 4A40 Whole blood 3.11E-01 -1.57E-02 -4.74E-02
Major depressive disorder 6A70-6A7Z Hippocampus 9.29E-01 5.81E-03 2.93E-02
Major depressive disorder 6A70-6A7Z Whole blood 2.76E-01 -6.38E-02 -2.61E-01
Melanoma 2C30 Skin 1.38E-01 1.71E-01 2.55E-01
Multiple myeloma 2A83.1 Peripheral blood 2.66E-01 5.40E-02 2.48E-01
Multiple myeloma 2A83.1 Bone marrow 1.61E-01 -3.27E-02 -1.83E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.32E-01 3.04E-02 8.77E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.62E-04 1.20E-01 7.03E-01
Myelofibrosis 2A20.2 Whole blood 6.64E-01 3.70E-02 2.44E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.20E-02 -2.09E-01 -3.26E-01
Myopathy 8C70.6 Muscle tissue 1.83E-01 -1.29E-01 -5.71E-01
Neonatal sepsis KA60 Whole blood 3.98E-02 -1.78E-02 -7.57E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.49E-05 -5.23E-01 -2.42E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.60E-01 -7.20E-02 -4.60E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.60E-01 -3.25E-02 -4.18E-01
Olive pollen allergy CA08.00 Peripheral blood 9.07E-01 -5.72E-02 -2.47E-01
Oral cancer 2B6E Oral tissue 5.72E-02 -1.48E-01 -6.73E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.43E-01 3.86E-03 2.93E-02
Osteoporosis FB83.1 Bone marrow 6.46E-01 2.53E-03 3.96E-02
Ovarian cancer 2C73 Ovarian tissue 6.34E-01 -4.58E-02 -1.17E-01
Pancreatic cancer 2C10 Pancreas 9.21E-03 -1.03E-01 -4.29E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.04E-01 -2.96E-02 -1.57E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.41E-01 -4.68E-02 -3.84E-01
Pituitary cancer 2D12 Pituitary tissue 1.22E-01 1.99E-01 6.06E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.64E-02 2.85E-01 1.51E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.04E-02 -6.90E-02 -4.54E-01
Polycythemia vera 2A20.4 Whole blood 2.57E-01 -3.62E-03 -2.55E-02
Pompe disease 5C51.3 Biceps muscle 3.48E-01 -1.79E-01 -5.09E-01
Preterm birth KA21.4Z Myometrium 7.38E-01 4.09E-02 4.27E-01
Prostate cancer 2C82 Prostate 2.52E-07 9.41E-01 2.03E+00
Psoriasis EA90 Skin 4.76E-02 7.67E-02 2.36E-01
Rectal cancer 2B92 Rectal colon tissue 3.58E-01 2.69E-02 1.85E-01
Renal cancer 2C90-2C91 Kidney 7.24E-03 -4.61E-01 -1.44E+00
Retinoblastoma 2D02.2 Uvea 2.99E-05 -6.24E-01 -2.13E+00
Rheumatoid arthritis FA20 Synovial tissue 9.39E-01 1.01E-01 4.77E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.14E-01 2.54E-02 2.16E-01
Schizophrenia 6A20 Prefrontal cortex 3.20E-01 5.28E-03 2.74E-02
Schizophrenia 6A20 Superior temporal cortex 4.76E-02 -5.47E-02 -4.21E-01
Scleroderma 4A42.Z Whole blood 4.31E-02 -1.51E-01 -1.00E+00
Seizure 8A60-8A6Z Whole blood 4.45E-01 1.73E-01 7.74E-01
Sensitive skin EK0Z Skin 6.07E-01 4.58E-02 5.76E-01
Sepsis with septic shock 1G41 Whole blood 2.73E-05 -1.26E-01 -5.41E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.45E-01 2.93E-01 1.22E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.53E-01 -4.82E-02 -7.81E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.13E-01 -4.64E-02 -5.08E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.54E-01 -4.68E-02 -4.33E-01
Skin cancer 2C30-2C3Z Skin 4.67E-18 2.39E-01 6.68E-01
Thrombocythemia 3B63 Whole blood 5.00E-01 4.83E-02 3.10E-01
Thrombocytopenia 3B64 Whole blood 1.00E+00 -5.03E-02 -1.02E-01
Thyroid cancer 2D10 Thyroid 2.29E-01 3.53E-02 1.23E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.17E-01 -8.89E-02 -3.32E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.20E-01 1.68E-01 1.83E+00
Type 2 diabetes 5A11 Liver tissue 1.52E-01 -2.29E-01 -1.30E+00
Ureter cancer 2C92 Urothelium 5.44E-01 -5.48E-02 -2.80E-01
Uterine cancer 2C78 Endometrium tissue 8.59E-06 -1.05E-01 -3.35E-01
Vitiligo ED63.0 Skin 7.32E-01 1.56E-01 4.29E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Interactive influence of N6AMT1 and As3MT genetic variations on arsenic metabolism in the population of Inner Mongolia, China. Toxicol Sci. 2017 Jan;155(1):124-134.