Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEOTVYU)

DME Name Thymidylate kinase (DTYMK)
Synonyms Deoxythymidine 5'-monophosphate kinase; Deoxythymidine monophosphate kinase TMPK; dTMP kinase; CDC8; DTYMK; TMPK; TYMK
Gene Name DTYMK
UniProt ID
KTHY_HUMAN
INTEDE ID
DME0415
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1841
EC Number EC: 2.7.4.9
Transferase
Kinase
Phosphotransferase
EC: 2.7.4.9
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAARRGALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKK
SDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQP
DVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDA
SKSIEAVHEDIRVLSEDAIRTATEKPLGELWK
Function This enzyme catalyzes the conversion of dTMP to dTDP.
KEGG Pathway
Metabolic pathways (hsa01100 )
Pyrimidine metabolism (hsa00240 )
Reactome Pathway
Interconversion of nucleotide di- and triphosphates (R-HSA-499943 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
3'-Azido-3'-Deoxythymidine-5'-Monophosphate DMU08MN Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.59E-10 -2.64E-01 -8.56E-01
Alopecia ED70 Skin from scalp 6.00E-01 1.17E-02 4.58E-02
Alzheimer's disease 8A20 Entorhinal cortex 4.14E-05 1.22E-01 5.85E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.53E-01 9.03E-02 4.85E-01
Aortic stenosis BB70 Calcified aortic valve 9.55E-01 -6.15E-02 -1.25E-01
Apnea 7A40 Hyperplastic tonsil 5.05E-01 -7.58E-02 -4.37E-01
Arthropathy FA00-FA5Z Peripheral blood 2.28E-01 -1.39E-01 -9.45E-01
Asthma CA23 Nasal and bronchial airway 2.81E-05 2.41E-01 5.99E-01
Atopic dermatitis EA80 Skin 1.71E-09 2.55E-01 3.04E+00
Autism 6A02 Whole blood 8.84E-03 -8.38E-02 -3.96E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.17E-01 3.12E-02 1.94E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.33E-01 4.38E-02 3.11E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.75E-05 -1.77E-01 -5.82E-01
Batten disease 5C56.1 Whole blood 4.91E-01 -7.07E-03 -9.10E-02
Behcet's disease 4A62 Peripheral blood 4.63E-01 -4.86E-02 -2.48E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.11E-01 5.69E-02 3.48E-01
Bladder cancer 2C94 Bladder tissue 2.40E-17 8.52E-01 1.03E+01
Breast cancer 2C60-2C6Z Breast tissue 2.95E-65 3.97E-01 1.20E+00
Cardioembolic stroke 8B11.20 Whole blood 1.02E-02 -1.21E-01 -5.04E-01
Cervical cancer 2C77 Cervical tissue 5.78E-02 3.00E-01 8.47E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.06E-01 -2.41E-02 -1.38E-01
Chronic hepatitis C 1E51.1 Whole blood 9.91E-01 5.70E-02 3.26E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.33E-01 5.10E-02 2.39E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.86E-01 2.02E-02 1.01E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.21E-02 1.64E-01 9.58E-01
Colon cancer 2B90 Colon tissue 2.35E-43 4.63E-01 1.55E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.26E-01 3.18E-02 1.74E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.11E-01 -6.50E-02 -1.63E-01
Endometriosis GA10 Endometrium tissue 3.31E-02 -8.69E-02 -2.37E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.55E-01 8.70E-02 8.09E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.87E-03 -1.46E-01 -5.15E-01
Gastric cancer 2B72 Gastric tissue 1.19E-01 2.50E-01 1.69E+00
Glioblastopma 2A00.00 Nervous tissue 6.00E-154 7.17E-01 2.13E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.96E-05 4.80E-01 8.06E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.12E-03 3.33E-01 1.17E+00
Head and neck cancer 2D42 Head and neck tissue 1.12E-16 4.92E-01 1.37E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.64E-01 -7.67E-02 -2.74E-01
Huntington's disease 8A01.10 Whole blood 8.33E-01 7.43E-03 4.02E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.90E-01 2.79E-01 1.11E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.61E-01 4.13E-02 5.08E-01
Influenza 1E30 Whole blood 1.80E-03 -3.80E-01 -2.99E+00
Interstitial cystitis GC00.3 Bladder tissue 3.55E-02 1.68E-01 1.82E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.28E-02 2.17E-01 1.15E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.14E-01 -5.65E-02 -1.81E-01
Ischemic stroke 8B11 Peripheral blood 2.72E-01 7.01E-02 3.31E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.00E-10 -2.87E-01 -1.07E+00
Lateral sclerosis 8B60.4 Skin 2.73E-01 4.39E-02 4.02E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.84E-01 -1.52E-02 -8.09E-02
Liver cancer 2C12.0 Liver tissue 8.76E-11 2.75E-01 1.07E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.56E-03 6.69E-01 1.80E+00
Lung cancer 2C25 Lung tissue 2.04E-73 5.22E-01 2.00E+00
Lupus erythematosus 4A40 Whole blood 1.90E-01 -8.16E-04 -3.50E-03
Major depressive disorder 6A70-6A7Z Hippocampus 1.00E-01 6.95E-02 4.39E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.49E-03 -6.84E-02 -3.28E-01
Melanoma 2C30 Skin 1.24E-02 1.81E-01 4.77E-01
Multiple myeloma 2A83.1 Peripheral blood 4.51E-01 -1.63E-01 -1.76E-01
Multiple myeloma 2A83.1 Bone marrow 8.16E-01 -1.76E-02 -8.25E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.54E-01 8.45E-02 2.08E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.64E-01 -1.12E-02 -5.28E-02
Myelofibrosis 2A20.2 Whole blood 2.89E-03 2.27E-01 1.87E+00
Myocardial infarction BA41-BA50 Peripheral blood 9.68E-04 -2.75E-01 -5.86E-01
Myopathy 8C70.6 Muscle tissue 5.19E-01 3.00E-03 2.16E-02
Neonatal sepsis KA60 Whole blood 1.43E-09 -2.55E-01 -9.61E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.09E-08 6.98E-01 3.84E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.30E-01 -1.77E-01 -7.50E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.53E-01 4.54E-02 3.03E-01
Olive pollen allergy CA08.00 Peripheral blood 8.80E-01 8.39E-02 3.67E-01
Oral cancer 2B6E Oral tissue 7.22E-04 2.93E-01 6.49E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.28E-01 2.03E-01 5.20E-01
Osteoporosis FB83.1 Bone marrow 2.08E-01 -6.11E-02 -1.98E-01
Ovarian cancer 2C73 Ovarian tissue 4.60E-04 3.30E-01 1.65E+00
Pancreatic cancer 2C10 Pancreas 8.66E-02 1.33E-01 3.97E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.05E-03 1.12E-01 1.51E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.51E-01 2.49E-02 1.43E-01
Pituitary cancer 2D12 Pituitary tissue 8.10E-01 8.39E-02 3.61E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.56E-01 4.51E-03 2.96E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.18E-01 2.07E-02 9.26E-02
Polycythemia vera 2A20.4 Whole blood 3.76E-05 1.10E-01 7.46E-01
Pompe disease 5C51.3 Biceps muscle 9.79E-03 -2.22E-01 -1.18E+00
Preterm birth KA21.4Z Myometrium 1.93E-01 -1.92E-01 -4.06E-01
Prostate cancer 2C82 Prostate 4.08E-03 2.14E-01 6.09E-01
Psoriasis EA90 Skin 6.58E-17 3.38E-01 1.09E+00
Rectal cancer 2B92 Rectal colon tissue 4.82E-03 4.03E-01 1.46E+00
Renal cancer 2C90-2C91 Kidney 6.07E-04 3.28E-01 1.67E+00
Retinoblastoma 2D02.2 Uvea 9.66E-10 9.86E-01 4.68E+00
Rheumatoid arthritis FA20 Synovial tissue 6.12E-01 5.86E-02 2.60E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.90E-01 -9.15E-03 -5.76E-02
Schizophrenia 6A20 Prefrontal cortex 1.33E-01 9.72E-02 2.71E-01
Schizophrenia 6A20 Superior temporal cortex 8.65E-01 -2.91E-02 -2.57E-01
Scleroderma 4A42.Z Whole blood 1.71E-01 -1.28E-01 -6.04E-01
Seizure 8A60-8A6Z Whole blood 3.68E-02 1.51E-01 4.09E-01
Sensitive skin EK0Z Skin 1.33E-01 2.49E-01 1.55E+00
Sepsis with septic shock 1G41 Whole blood 1.69E-06 -1.60E-01 -6.94E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.20E-01 4.04E-02 1.36E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.97E-01 -5.59E-03 -4.26E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 9.07E-01 1.67E-02 9.33E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.53E-01 -4.52E-02 -1.92E-01
Skin cancer 2C30-2C3Z Skin 2.05E-47 5.39E-01 1.55E+00
Thrombocythemia 3B63 Whole blood 2.29E-04 1.43E-01 1.25E+00
Thrombocytopenia 3B64 Whole blood 5.51E-02 2.88E-01 5.05E-01
Thyroid cancer 2D10 Thyroid 4.95E-06 1.35E-01 4.81E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.03E-01 -1.01E-01 -4.24E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.89E-01 1.02E-01 5.83E-01
Type 2 diabetes 5A11 Liver tissue 4.56E-01 1.34E-01 4.49E-01
Ureter cancer 2C92 Urothelium 2.07E-01 1.07E-02 6.13E-02
Uterine cancer 2C78 Endometrium tissue 4.77E-06 2.21E-01 5.86E-01
Vitiligo ED63.0 Skin 2.41E-01 5.21E-04 2.80E-03
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Azidothymidine-triphosphate impairs mitochondrial dynamics by disrupting the quality control system. Redox Biol. 2017 Oct;13:407-417.