Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEP6GT1)

DME Name Small intestine reductase (AKR1B10)
Synonyms Aldo-keto reductase family 1 member B10; SI reductase; Aldose reductase-related protein; Aldose reductase-like; AKR1B10; AKR1B11; ARL-1; ARP; hARP
Gene Name AKR1B10
UniProt ID
AK1BA_HUMAN
INTEDE ID
DME0398
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
57016
EC Number EC: 1.1.1.21
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.21
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY
Function
This enzyme catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. It displays strong enzymatic activity toward all-trans- retinal, 9-cis-retinal, and 13-cis-retinal. It plays a critical role in detoxifying dietary and lipid-derived unsaturated carbonyls, such as crotonaldehyde, 4- hydroxynonenal, trans-2-hexenal, trans-2,4-hexadienal and their glutathione-conjugates carbonyls (GS-carbonyls).
KEGG Pathway
Folate biosynthesis (hsa00790 )
Fructose and mannose metabolism (hsa00051 )
Galactose metabolism (hsa00052 )
Glycerolipid metabolism (hsa00561 )
Metabolic pathways (hsa01100 )
Pentose and glucuronate interconversions (hsa00040 )
Reactome Pathway
Retinoid metabolism and transport (R-HSA-975634 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phenanthrene-9,10-dione DMG8KS9 Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.07E-05 3.93E-02 2.67E-01
Alopecia ED70 Skin from scalp 3.12E-01 -2.58E-01 -2.61E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.61E-01 -4.15E-02 -2.61E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.69E-01 -1.65E-01 -1.05E+00
Aortic stenosis BB70 Calcified aortic valve 9.09E-01 -1.83E-01 -3.80E-01
Apnea 7A40 Hyperplastic tonsil 7.42E-02 -3.31E+00 -3.34E+00
Arthropathy FA00-FA5Z Peripheral blood 5.70E-01 8.24E-02 4.86E-01
Asthma CA23 Nasal and bronchial airway 3.80E-10 2.78E+00 1.36E+00
Atopic dermatitis EA80 Skin 1.42E-08 2.49E+00 7.15E+00
Autism 6A02 Whole blood 7.37E-03 -1.93E-01 -8.54E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.49E-01 -2.00E-01 -8.45E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.17E-01 -4.15E-02 -2.98E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.92E-15 -5.00E-01 -1.24E+00
Batten disease 5C56.1 Whole blood 4.03E-01 -4.80E-02 -3.28E-01
Behcet's disease 4A62 Peripheral blood 1.62E-01 9.59E-02 6.92E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.74E-01 1.97E-02 1.37E-01
Bladder cancer 2C94 Bladder tissue 6.74E-01 -7.75E-01 -5.47E-01
Breast cancer 2C60-2C6Z Breast tissue 3.42E-02 -5.90E-02 -6.89E-02
Cardioembolic stroke 8B11.20 Whole blood 2.14E-03 -1.40E-01 -7.35E-01
Cervical cancer 2C77 Cervical tissue 3.40E-04 -1.00E+00 -1.13E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.77E-01 3.67E-04 2.25E-03
Chronic hepatitis C 1E51.1 Whole blood 1.05E-02 1.02E-01 7.65E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.11E-03 9.42E-02 6.13E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.99E-07 2.52E+00 9.84E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.01E-01 6.81E-01 1.97E+00
Colon cancer 2B90 Colon tissue 3.19E-198 -4.07E+00 -5.86E+00
Coronary artery disease BA80-BA8Z Peripheral blood 4.35E-01 -7.10E-02 -5.04E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.09E-01 -9.61E-02 -5.07E-01
Endometriosis GA10 Endometrium tissue 9.43E-03 1.65E-01 3.48E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.75E-01 8.72E-02 6.03E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.34E-03 -1.14E-01 -6.72E-01
Gastric cancer 2B72 Gastric tissue 1.76E-01 -2.98E+00 -1.39E+00
Glioblastopma 2A00.00 Nervous tissue 1.55E-06 9.51E-02 2.97E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.78E-01 2.63E-03 1.63E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.00E-01 -2.65E-01 -9.17E-01
Head and neck cancer 2D42 Head and neck tissue 2.63E-10 1.82E+00 8.15E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.60E-02 -1.02E-01 -3.15E-01
Huntington's disease 8A01.10 Whole blood 5.05E-01 -2.38E-02 -1.73E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.79E-02 1.61E-01 7.34E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.86E-01 2.60E-02 3.47E-01
Influenza 1E30 Whole blood 4.44E-01 4.99E-02 7.86E-01
Interstitial cystitis GC00.3 Bladder tissue 8.59E-02 -1.30E+00 -9.43E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.74E-01 -1.31E-01 -2.29E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.36E-01 -1.42E-01 -2.23E-01
Ischemic stroke 8B11 Peripheral blood 5.20E-01 -3.06E-02 -2.12E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.62E-03 6.46E-02 2.41E-01
Lateral sclerosis 8B60.4 Skin 7.91E-01 -3.01E-02 -1.33E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.93E-02 2.58E-01 1.38E+00
Liver cancer 2C12.0 Liver tissue 2.44E-31 5.33E+00 4.44E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.70E-04 5.81E+00 5.18E+00
Lung cancer 2C25 Lung tissue 4.46E-96 1.16E+00 1.81E+00
Lupus erythematosus 4A40 Whole blood 3.95E-04 8.38E-02 3.18E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.36E-01 2.19E-02 1.52E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.30E-01 6.17E-02 2.24E-01
Melanoma 2C30 Skin 6.71E-01 6.54E-01 4.16E-01
Multiple myeloma 2A83.1 Peripheral blood 3.25E-01 2.43E-02 1.81E-01
Multiple myeloma 2A83.1 Bone marrow 1.37E-03 -6.04E-01 -2.11E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.40E-01 7.80E-03 3.57E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.62E-01 -1.44E-02 -6.53E-02
Myelofibrosis 2A20.2 Whole blood 2.43E-04 -1.11E-01 -8.27E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.34E-01 -3.91E-03 -6.65E-03
Myopathy 8C70.6 Muscle tissue 4.74E-01 -2.17E-01 -2.30E-01
Neonatal sepsis KA60 Whole blood 7.28E-01 -1.35E-02 -6.86E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.94E-03 -5.54E-01 -1.64E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.62E-01 -9.63E-02 -8.42E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.60E-01 6.93E-02 2.71E-01
Olive pollen allergy CA08.00 Peripheral blood 4.41E-01 -3.81E-02 -2.23E-01
Oral cancer 2B6E Oral tissue 8.29E-01 -1.60E-01 -7.21E-02
Osteoarthritis FA00-FA0Z Synovial tissue 5.47E-01 5.48E-01 7.95E-01
Osteoporosis FB83.1 Bone marrow 9.64E-02 -4.54E-01 -1.32E+00
Ovarian cancer 2C73 Ovarian tissue 1.76E-03 2.13E-01 4.10E-01
Pancreatic cancer 2C10 Pancreas 2.04E-03 2.09E+00 1.14E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 3.02E-01 -7.97E-02 -5.85E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.21E-01 -1.16E-01 -8.70E-01
Pituitary cancer 2D12 Pituitary tissue 2.64E-01 1.23E+00 1.41E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.36E-03 1.55E+00 1.94E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.40E-01 1.38E-01 3.96E-01
Polycythemia vera 2A20.4 Whole blood 8.08E-03 -7.33E-02 -5.58E-01
Pompe disease 5C51.3 Biceps muscle 5.36E-03 -1.91E+00 -2.51E+00
Preterm birth KA21.4Z Myometrium 2.76E-01 1.91E-01 7.37E-01
Prostate cancer 2C82 Prostate 8.76E-02 -2.47E-01 -1.91E-01
Psoriasis EA90 Skin 8.35E-67 5.29E+00 5.44E+00
Rectal cancer 2B92 Rectal colon tissue 2.45E-08 -2.70E+00 -5.84E+00
Renal cancer 2C90-2C91 Kidney 8.30E-01 -1.10E-01 -5.50E-02
Retinoblastoma 2D02.2 Uvea 5.73E-02 -1.72E-01 -8.98E-01
Rheumatoid arthritis FA20 Synovial tissue 9.59E-04 -1.00E+00 -2.00E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.16E-01 5.76E-02 6.05E-02
Schizophrenia 6A20 Prefrontal cortex 2.86E-01 1.08E-02 4.44E-02
Schizophrenia 6A20 Superior temporal cortex 1.24E-01 -5.50E-02 -3.29E-01
Scleroderma 4A42.Z Whole blood 1.41E-02 7.57E-02 6.10E-01
Seizure 8A60-8A6Z Whole blood 4.84E-02 7.09E-02 4.09E-01
Sensitive skin EK0Z Skin 1.91E-01 1.47E+00 2.11E+00
Sepsis with septic shock 1G41 Whole blood 1.64E-07 1.09E-01 4.95E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.62E-01 1.17E-01 4.31E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.52E-01 1.66E-01 4.36E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.29E-01 2.85E-01 2.93E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.13E-01 8.26E-02 3.61E-01
Skin cancer 2C30-2C3Z Skin 2.88E-03 3.23E-01 2.79E-01
Thrombocythemia 3B63 Whole blood 6.24E-01 -5.51E-02 -3.74E-01
Thrombocytopenia 3B64 Whole blood 5.65E-02 2.72E-01 1.52E+00
Thyroid cancer 2D10 Thyroid 2.81E-05 1.10E-01 2.19E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.43E-08 -1.47E+00 -2.57E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.88E-01 1.27E-01 5.95E-01
Type 2 diabetes 5A11 Liver tissue 8.24E-01 -2.13E-01 -2.41E-01
Ureter cancer 2C92 Urothelium 8.76E-01 -8.76E-02 -3.60E-01
Uterine cancer 2C78 Endometrium tissue 3.39E-07 1.63E+00 6.82E-01
Vitiligo ED63.0 Skin 2.13E-01 -3.81E-01 -5.54E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Exposure to 9,10-phenanthrenequinone accelerates malignant progression of lung cancer cells through up-regulation of aldo-keto reductase 1B10. Toxicol Appl Pharmacol. 2014 Jul 15;278(2):180-9.