General Information of Drug-Metabolizing Enzyme (DME) (ID: DEP7BTH)

DME Name Leucyl-tRNA synthetase (LARS2)
Synonyms Mitochondrial leucine--tRNA ligase; LeuRS; KIAA0028; LARS2
Gene Name LARS2
UniProt ID
SYLM_HUMAN
INTEDE ID
DME0499
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
23395
EC Number EC: 6.1.1.4
Ligase
Carbon-oxygen ligase
Aminoacyl tRNA synthetase
EC: 6.1.1.4
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MASVWQRLGFYASLLKRQLNGGPDVIKWERRVIPGCTRSIYSATGKWTKEYTLQTRKDVE
KWWHQRIKEQASKISEADKSKPKFYVLSMFPYPSGKLHMGHVRVYTISDTIARFQKMRGM
QVINPMGWDAFGLPAENAAVERNLHPQSWTQSNIKHMRKQLDRLGLCFSWDREITTCLPD
YYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVDEHGCSWRSGAKVEQKYLRQ
WFIKTTAYAKAMQDALADLPEWYGIKGMQAHWIGDCVGCHLDFTLKVHGQATGEKLTAYT
ATPEAIYGTSHVAISPSHRLLHGHSSLKEALRMALVPGKDCLTPVMAVNMLTQQEVPVVI
LAKADLEGSLDSKIGIPSTSSEDTILAQTLGLAYSEVIETLPDGTERLSSSAEFTGMTRQ
DAFLALTQKARGKRVGGDVTSDKLKDWLISRQRYWGTPIPIVHCPVCGPTPVPLEDLPVT
LPNIASFTGKGGPPLAMASEWVNCSCPRCKGAAKRETDTMDTFVDSAWYYFRYTDPHNPH
SPFNTAVADYWMPVDLYIGGKEHAVMHLFYARFFSHFCHDQKMVKHREPFHKLLAQGLIK
GQTFRLPSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGID
TIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWTLTTRFIEARASGKSPQPQLLSNK
EKAEARKLWEYKNSVISQVTTHFTEDFSLNSAISQLMGLSNALSQASQSVILHSPEFEDA
LCALMVMAAPLAPHVTSEIWAGLALVPRKLCAHYTWDASVLLQAWPAVDPEFLQQPEVVQ
MAVLINNKACGKIPVPQQVARDQDKVHEFVLQSELGVRLLQGRSIKKSFLSPRTALINFL
VQD
Function This enzyme attaches leucine to its cognate tRNA.
KEGG Pathway
Aminoacyl-tRNA biosynthesis (hsa00970 )
Reactome Pathway
Mitochondrial tRNA aminoacylation (R-HSA-379726 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-leucine DMQHN7I Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
L-leucine Discovery agent [N.A.] Investigative Km = 0.045 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.51E-01 -5.90E-03 -1.40E-02
Alopecia ED70 Skin from scalp 7.99E-01 -5.28E-04 -1.98E-03
Alzheimer's disease 8A20 Entorhinal cortex 2.92E-02 -2.04E-02 -1.01E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.76E-02 3.53E-01 1.07E+00
Aortic stenosis BB70 Calcified aortic valve 3.46E-01 -2.11E-01 -5.50E-01
Apnea 7A40 Hyperplastic tonsil 2.84E-01 -1.20E-01 -4.37E-01
Arthropathy FA00-FA5Z Peripheral blood 1.70E-01 -1.04E-01 -4.79E-01
Asthma CA23 Nasal and bronchial airway 1.58E-02 1.41E-01 2.15E-01
Atopic dermatitis EA80 Skin 6.63E-02 1.65E-01 7.29E-01
Autism 6A02 Whole blood 8.20E-01 -1.09E-01 -3.84E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.45E-02 6.36E-01 2.18E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.93E-01 -1.28E-01 -6.48E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.69E-01 4.64E-02 1.43E-01
Batten disease 5C56.1 Whole blood 3.08E-01 -1.44E-01 -1.26E+00
Behcet's disease 4A62 Peripheral blood 8.01E-01 -7.44E-02 -5.17E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.56E-01 -4.38E-02 -2.09E-01
Bladder cancer 2C94 Bladder tissue 1.53E-04 -4.03E-01 -2.36E+00
Breast cancer 2C60-2C6Z Breast tissue 5.99E-44 4.91E-01 1.03E+00
Cardioembolic stroke 8B11.20 Whole blood 3.18E-02 -1.35E-01 -6.03E-01
Cervical cancer 2C77 Cervical tissue 1.88E-01 1.03E-02 2.60E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.08E-01 3.76E-02 5.82E-02
Chronic hepatitis C 1E51.1 Whole blood 4.59E-01 -1.78E-01 -7.93E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.05E-01 2.22E-02 7.14E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.62E-01 1.03E-01 3.76E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.67E-02 -3.72E-01 -1.34E+00
Colon cancer 2B90 Colon tissue 4.49E-15 2.74E-01 6.79E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.07E-02 3.36E-01 1.33E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.12E-01 -2.73E-01 -9.69E-01
Endometriosis GA10 Endometrium tissue 4.63E-02 -5.89E-01 -1.25E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.01E-01 9.65E-03 4.27E-02
Familial hypercholesterolemia 5C80.00 Whole blood 4.14E-02 2.16E-01 8.99E-01
Gastric cancer 2B72 Gastric tissue 2.29E-01 7.60E-01 8.12E-01
Glioblastopma 2A00.00 Nervous tissue 8.07E-09 2.58E-01 5.26E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.23E-01 8.34E-02 1.55E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.68E-05 1.31E+00 1.86E+00
Head and neck cancer 2D42 Head and neck tissue 9.48E-10 -3.80E-01 -1.06E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.59E-01 -1.39E-02 -5.54E-02
Huntington's disease 8A01.10 Whole blood 4.63E-01 -1.15E-01 -7.17E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.06E-01 3.12E-01 9.62E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.19E-04 2.72E-01 1.63E+00
Influenza 1E30 Whole blood 1.02E-02 -1.06E+00 -3.86E+00
Interstitial cystitis GC00.3 Bladder tissue 5.43E-01 -8.09E-02 -8.52E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.14E-03 2.54E-01 8.12E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.60E-01 -3.74E-01 -5.45E-01
Ischemic stroke 8B11 Peripheral blood 6.63E-01 -2.86E-02 -1.01E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.03E-11 -8.39E-01 -1.36E+00
Lateral sclerosis 8B60.4 Skin 3.52E-02 4.78E-01 2.24E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 6.46E-02 5.79E-01 1.49E+00
Liver cancer 2C12.0 Liver tissue 3.95E-01 -5.65E-02 -1.95E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.82E-02 -2.94E-01 -7.94E-01
Lung cancer 2C25 Lung tissue 1.08E-28 3.14E-01 9.07E-01
Lupus erythematosus 4A40 Whole blood 6.02E-04 -1.43E-01 -4.54E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.42E-01 -5.11E-02 -2.70E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.30E-01 -1.91E-01 -2.82E-01
Melanoma 2C30 Skin 5.46E-01 -1.59E-01 -2.21E-01
Multiple myeloma 2A83.1 Peripheral blood 2.12E-01 -3.57E-01 -6.79E-01
Multiple myeloma 2A83.1 Bone marrow 2.89E-10 2.24E-01 4.32E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.18E-03 -4.43E-01 -1.67E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.05E-02 5.95E-02 1.66E-01
Myelofibrosis 2A20.2 Whole blood 9.06E-01 3.69E-02 2.76E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.17E-01 -1.27E-01 -1.39E-01
Myopathy 8C70.6 Muscle tissue 4.21E-01 1.99E-02 1.11E-01
Neonatal sepsis KA60 Whole blood 1.41E-08 -3.43E-01 -9.72E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.38E-05 1.15E+00 2.46E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.62E-01 -1.89E-01 -6.32E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.31E-01 -1.65E-01 -6.62E-01
Olive pollen allergy CA08.00 Peripheral blood 6.03E-02 -6.05E-01 -1.29E+00
Oral cancer 2B6E Oral tissue 1.40E-04 4.07E-01 9.81E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.95E-02 4.25E-01 7.96E-01
Osteoporosis FB83.1 Bone marrow 1.17E-02 -5.80E-01 -2.26E+00
Ovarian cancer 2C73 Ovarian tissue 2.11E-04 1.07E+00 2.66E+00
Pancreatic cancer 2C10 Pancreas 2.92E-01 6.04E-02 1.17E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.50E-01 1.45E-02 4.36E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.73E-02 2.00E-01 7.67E-01
Pituitary cancer 2D12 Pituitary tissue 5.79E-01 -1.98E-01 -3.99E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.46E-01 6.21E-02 2.43E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.31E-01 -2.22E-02 -1.14E-01
Polycythemia vera 2A20.4 Whole blood 8.24E-04 -1.52E-01 -1.01E+00
Pompe disease 5C51.3 Biceps muscle 7.35E-03 7.78E-01 2.40E+00
Preterm birth KA21.4Z Myometrium 3.23E-01 -2.32E-01 -9.08E-01
Prostate cancer 2C82 Prostate 4.33E-04 5.01E-01 9.35E-01
Psoriasis EA90 Skin 2.29E-02 -5.68E-02 -1.97E-01
Rectal cancer 2B92 Rectal colon tissue 4.25E-04 3.11E-01 2.16E+00
Renal cancer 2C90-2C91 Kidney 5.84E-02 -6.10E-01 -1.05E+00
Retinoblastoma 2D02.2 Uvea 3.17E-01 -2.21E-01 -1.22E+00
Rheumatoid arthritis FA20 Synovial tissue 1.16E-02 2.02E-01 4.43E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.10E-01 4.50E-02 2.54E-01
Schizophrenia 6A20 Prefrontal cortex 9.24E-02 -1.97E-01 -4.20E-01
Schizophrenia 6A20 Superior temporal cortex 1.08E-01 2.05E-01 7.73E-01
Scleroderma 4A42.Z Whole blood 9.09E-04 -1.50E-01 -1.35E+00
Seizure 8A60-8A6Z Whole blood 7.50E-02 -1.61E-01 -6.62E-01
Sensitive skin EK0Z Skin 4.85E-01 -1.33E-01 -9.62E-01
Sepsis with septic shock 1G41 Whole blood 9.26E-34 -4.96E-01 -1.52E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.22E-01 -2.23E-01 -5.37E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.66E-03 -4.49E-01 -9.24E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.33E-01 -3.76E-01 -1.65E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.97E-01 3.14E-01 9.37E-01
Skin cancer 2C30-2C3Z Skin 1.72E-11 3.97E-01 1.02E+00
Thrombocythemia 3B63 Whole blood 7.21E-01 -3.14E-02 -2.37E-01
Thrombocytopenia 3B64 Whole blood 6.77E-01 1.42E-01 3.44E-01
Thyroid cancer 2D10 Thyroid 1.56E-10 -2.16E-01 -9.72E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.52E-01 -1.39E-01 -3.17E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.69E-01 -1.17E-01 -3.45E-01
Type 2 diabetes 5A11 Liver tissue 4.98E-01 2.30E-01 7.57E-01
Ureter cancer 2C92 Urothelium 1.53E-01 6.20E-02 5.23E-01
Uterine cancer 2C78 Endometrium tissue 7.32E-01 5.81E-02 1.19E-01
Vitiligo ED63.0 Skin 8.72E-01 -7.52E-02 -5.69E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Expression and characterization of the human mitochondrial leucyl-tRNA synthetase. Biochim Biophys Acta. 2000 Feb 29;1490(3):245-58.