Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEP8X02)

DME Name Fucosyltransferase X (FUT10)
Synonyms Galactoside 3-L-fucosyltransferase 10; Alpha-(1,3)-fucosyltransferase 10; Fucosyltransferase 10; FUT10; Fuc-TX; FucT-X
Gene Name FUT10
UniProt ID
FUT10_HUMAN
INTEDE ID
DME0528
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
84750
EC Number EC: 2.4.1.65
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.65
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MVRIQRRKLLASCLCVTATVFLLVTLQVMVELGKFERKEFKSSSLQDGHTKMEEAPTHLN
SFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTK
AFLFYGTDFNIDSLPLPRKAHHDWAVFHEESPKNNYKLFHKPVITLFNYTATFSRHSHLP
LTTQYLESIEVLKSLRYLVPLQSKNKLRKRLAPLVYVQSDCDPPSDRDSYVRELMTYIEV
DSYGECLRNKDLPQQLKNPASMDADGFYRIIAQYKFILAFENAVCDDYITEKFWRPLKLG
VVPVYYGSPSITDWLPSNKSAILVSEFSHPRELASYIRRLDSDDRLYEAYVEWKLKGEIS
NQRLLTALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSC
PEPTVFAFSPLRTPPLSSLREMWISSFEQSKKEAQALRWLVDRNQNFSSQEFWGLVFKD
Function This enzyme is a probable fucosyltransferase.
Reactome Pathway
Lewis blood group biosynthesis (R-HSA-9037629 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
GDP-l-fucose DM9ARQ1 N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.92E-04 1.19E-01 6.09E-01
Alopecia ED70 Skin from scalp 5.61E-03 -1.16E-01 -4.67E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.51E-01 2.19E-02 1.13E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.42E-02 1.29E-01 1.19E+00
Aortic stenosis BB70 Calcified aortic valve 8.53E-01 -2.41E-02 -5.42E-02
Apnea 7A40 Hyperplastic tonsil 1.25E-02 -5.21E-01 -1.01E+00
Arthropathy FA00-FA5Z Peripheral blood 8.43E-01 8.73E-02 4.97E-01
Asthma CA23 Nasal and bronchial airway 4.18E-07 -2.39E-01 -4.84E-01
Atopic dermatitis EA80 Skin 6.68E-03 -1.13E-01 -7.58E-01
Autism 6A02 Whole blood 2.94E-01 -9.83E-02 -3.58E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.95E-01 -3.22E-02 -2.08E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.84E-02 -2.31E-01 -7.17E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.83E-01 -4.57E-02 -1.83E-01
Batten disease 5C56.1 Whole blood 2.16E-01 6.07E-01 1.67E+00
Behcet's disease 4A62 Peripheral blood 5.06E-01 -1.14E-02 -5.74E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.67E-01 -1.19E-02 -7.65E-02
Bladder cancer 2C94 Bladder tissue 2.93E-03 -3.90E-01 -1.69E+00
Breast cancer 2C60-2C6Z Breast tissue 1.22E-14 -1.64E-01 -4.93E-01
Cardioembolic stroke 8B11.20 Whole blood 7.19E-02 2.02E-01 8.65E-01
Cervical cancer 2C77 Cervical tissue 3.31E-02 -1.42E-01 -5.64E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.95E-01 1.83E-02 5.60E-02
Chronic hepatitis C 1E51.1 Whole blood 2.73E-01 -1.34E-01 -5.75E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.30E-02 8.97E-02 3.85E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.09E-03 -6.18E-02 -3.83E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.61E-01 4.31E-04 1.95E-03
Colon cancer 2B90 Colon tissue 4.86E-01 2.30E-02 9.93E-02
Coronary artery disease BA80-BA8Z Peripheral blood 2.40E-01 4.28E-02 3.22E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.65E-01 -3.62E-01 -6.94E-01
Endometriosis GA10 Endometrium tissue 5.02E-01 -2.96E-02 -1.21E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.44E-01 -7.39E-02 -4.65E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.82E-08 -5.41E-01 -1.84E+00
Gastric cancer 2B72 Gastric tissue 1.45E-01 -3.55E-01 -1.82E+00
Glioblastopma 2A00.00 Nervous tissue 2.88E-04 -8.81E-02 -2.80E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.27E-01 -4.86E-02 -7.44E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.84E-03 1.34E-01 6.44E-01
Head and neck cancer 2D42 Head and neck tissue 7.18E-03 -7.83E-02 -4.33E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.82E-02 -9.79E-02 -4.12E-01
Huntington's disease 8A01.10 Whole blood 9.91E-01 5.82E-03 2.88E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.68E-01 1.06E-01 8.42E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.73E-01 -3.86E-02 -1.80E-01
Influenza 1E30 Whole blood 9.03E-01 -3.88E-02 -3.42E-01
Interstitial cystitis GC00.3 Bladder tissue 7.18E-01 1.03E-01 7.15E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.89E-01 3.73E-02 3.33E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.67E-01 7.89E-02 2.65E-01
Ischemic stroke 8B11 Peripheral blood 4.90E-01 4.78E-02 2.14E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.57E-01 3.31E-02 1.10E-01
Lateral sclerosis 8B60.4 Skin 1.65E-01 1.47E-01 8.12E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.77E-01 9.13E-02 2.80E-01
Liver cancer 2C12.0 Liver tissue 9.42E-05 -1.76E-01 -7.47E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.02E-01 7.42E-02 5.32E-01
Lung cancer 2C25 Lung tissue 3.20E-02 1.04E-02 5.27E-02
Lupus erythematosus 4A40 Whole blood 6.18E-01 -1.78E-02 -4.86E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.52E-01 -5.61E-02 -4.54E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.69E-02 2.00E-01 5.53E-01
Melanoma 2C30 Skin 7.99E-01 -5.09E-02 -6.75E-02
Multiple myeloma 2A83.1 Peripheral blood 8.79E-01 -1.29E-01 -5.17E-01
Multiple myeloma 2A83.1 Bone marrow 1.49E-04 3.71E-01 2.08E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.59E-02 3.16E-01 8.00E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.29E-01 -1.47E-02 -9.16E-02
Myelofibrosis 2A20.2 Whole blood 2.09E-01 -6.54E-02 -3.56E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.50E-01 4.48E-02 7.26E-02
Myopathy 8C70.6 Muscle tissue 3.38E-02 1.47E-01 1.34E+00
Neonatal sepsis KA60 Whole blood 3.86E-01 5.24E-02 2.15E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.49E-03 -4.28E-01 -1.36E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.73E-01 -1.86E-01 -9.35E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.41E-02 2.73E-01 1.26E+00
Olive pollen allergy CA08.00 Peripheral blood 3.99E-02 1.59E-01 1.31E+00
Oral cancer 2B6E Oral tissue 9.61E-04 -2.14E-01 -8.63E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.93E-01 1.18E-03 6.51E-03
Osteoporosis FB83.1 Bone marrow 6.04E-01 -3.97E-02 -1.32E-01
Ovarian cancer 2C73 Ovarian tissue 6.77E-01 -8.95E-02 -2.20E-01
Pancreatic cancer 2C10 Pancreas 1.44E-01 -1.74E-01 -7.69E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.43E-01 1.10E-02 4.28E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.06E-01 -1.21E-01 -4.63E-01
Pituitary cancer 2D12 Pituitary tissue 4.29E-02 2.26E-01 7.56E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.38E-02 2.33E-01 1.09E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.64E-01 -7.33E-02 -6.07E-01
Polycythemia vera 2A20.4 Whole blood 3.88E-03 -1.15E-01 -5.50E-01
Pompe disease 5C51.3 Biceps muscle 2.32E-02 2.86E-01 1.90E+00
Preterm birth KA21.4Z Myometrium 1.20E-01 -1.34E-01 -7.59E-01
Prostate cancer 2C82 Prostate 6.48E-04 -3.58E-01 -1.07E+00
Psoriasis EA90 Skin 3.39E-09 -1.38E-01 -4.62E-01
Rectal cancer 2B92 Rectal colon tissue 4.50E-01 1.51E-01 5.04E-01
Renal cancer 2C90-2C91 Kidney 9.45E-03 -5.00E-01 -1.32E+00
Retinoblastoma 2D02.2 Uvea 3.03E-05 -3.89E-01 -2.14E+00
Rheumatoid arthritis FA20 Synovial tissue 4.50E-01 2.00E-01 5.30E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.90E-01 4.39E-02 3.99E-01
Schizophrenia 6A20 Prefrontal cortex 1.61E-01 6.65E-02 2.24E-01
Schizophrenia 6A20 Superior temporal cortex 8.18E-01 -2.70E-02 -1.88E-01
Scleroderma 4A42.Z Whole blood 7.98E-02 -2.19E-01 -9.66E-01
Seizure 8A60-8A6Z Whole blood 5.10E-01 7.72E-02 5.38E-01
Sensitive skin EK0Z Skin 6.40E-01 -3.56E-02 -3.13E-01
Sepsis with septic shock 1G41 Whole blood 9.81E-01 -1.25E-03 -5.26E-03
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.00E-02 5.08E-01 1.82E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.13E-01 4.99E-02 1.65E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.36E-02 -8.65E-02 -1.21E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.71E-01 -1.03E-01 -3.11E-01
Skin cancer 2C30-2C3Z Skin 2.88E-05 -2.05E-01 -4.70E-01
Thrombocythemia 3B63 Whole blood 3.03E-01 -1.90E-03 -1.10E-02
Thrombocytopenia 3B64 Whole blood 5.09E-01 -2.80E-02 -1.37E-01
Thyroid cancer 2D10 Thyroid 1.12E-02 -1.12E-01 -4.51E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.53E-02 1.60E-01 6.99E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.49E-01 -1.35E-01 -1.03E+00
Type 2 diabetes 5A11 Liver tissue 8.25E-01 -4.95E-02 -3.30E-01
Ureter cancer 2C92 Urothelium 2.70E-01 -3.83E-03 -2.59E-02
Uterine cancer 2C78 Endometrium tissue 2.89E-05 -1.53E-01 -5.56E-01
Vitiligo ED63.0 Skin 8.40E-01 -2.20E-02 -1.61E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Activity, splice variants, conserved peptide motifs, and phylogeny of two new alpha1,3-fucosyltransferase families (FUT10 and FUT11). J Biol Chem. 2009 Feb 13;284(7):4723-38.