Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEPFD73)

DME Name Dehydrogenase/reductase retSDR2 (HSD17B11)
Synonyms
Cutaneous T-cell lymphoma-associated antigen HD-CL-03; Dehydrogenase/reductase SDR family member 8; Estradiol 17-beta-dehydrogenase 11; CTCL-associated antigen HD-CL-03; Retinal short-chain dehydrogenase/reductase 2; SDR16C2; Short chain dehydrogenase/reductase family 16C member 2; 17-beta-hydroxysteroid dehydrogenase 11; 17-beta-hydroxysteroid dehydrogenase XI; 17bHSD11; 17betaHSD11; 17betaHSDXI; DHRS8; HSD17B11; PAN1B; PSEC0029; UNQ207/PRO233; retSDR2; 17-beta-HSD 11; 17-beta-HSD XI
Gene Name HSD17B11
UniProt ID
DHB11_HUMAN
INTEDE ID
DME0611
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
51170
EC Number EC: 1.1.1.62
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.62
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MKFLLDILLLLPLLIVCSLESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLK
SKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNN
AGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVP
FLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPE
EVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ
Function
This enzyme can convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. And it may act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it.
Reactome Pathway
Estrogen biosynthesis (R-HSA-193144 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Hombreol DMZYB3S N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.38E-13 3.62E-01 1.25E+00
Alzheimer's disease 8A20 Entorhinal cortex 1.04E-01 4.65E-02 1.52E-01
Asthma CA23 Nasal and bronchial airway 5.58E-03 1.73E-01 2.14E-01
Behcet's disease 4A62 Peripheral blood 9.86E-01 -3.49E-02 -2.00E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.81E-01 1.64E-01 3.76E-01
Bladder cancer 2C94 Bladder tissue 8.15E-05 -6.52E-01 -3.20E+00
Breast cancer 2C60-2C6Z Breast tissue 9.87E-68 -1.45E+00 -1.63E+00
Colon cancer 2B90 Colon tissue 1.02E-101 -1.08E+00 -3.16E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.82E-01 1.52E-01 2.63E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.49E-01 -9.47E-03 -4.63E-02
Gastric cancer 2B72 Gastric tissue 1.30E-02 1.46E+00 5.05E+00
Glioblastopma 2A00.00 Nervous tissue 1.63E-71 6.60E-01 1.29E+00
Head and neck cancer 2D42 Head and neck tissue 4.48E-07 -7.08E-01 -6.76E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.07E-01 4.40E-01 6.98E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.32E-01 6.02E-02 3.94E-01
Interstitial cystitis GC00.3 Bladder tissue 5.55E-03 -3.16E-01 -2.11E+00
Ischemic stroke 8B11 Peripheral blood 9.07E-01 -1.12E-02 -4.76E-02
Liver cancer 2C12.0 Liver tissue 6.10E-02 -9.11E-02 -1.93E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.66E-06 -1.19E+00 -3.21E+00
Lung cancer 2C25 Lung tissue 9.52E-83 -8.07E-01 -2.31E+00
Lupus erythematosus 4A40 Whole blood 8.52E-10 4.06E-01 9.49E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.89E-01 -5.42E-02 -1.23E-01
Multiple myeloma 2A83.1 Bone marrow 3.81E-05 1.12E+00 2.94E+00
Multiple myeloma 2A83.1 Peripheral blood 2.89E-01 5.89E-01 9.49E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.31E-02 -5.17E-01 -1.04E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.41E-05 2.36E-01 6.77E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.95E-01 3.72E-02 7.45E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.97E-06 1.25E+00 2.24E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.20E-01 -8.35E-02 -2.75E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.73E-01 6.32E-02 1.24E-01
Olive pollen allergy CA08.00 Peripheral blood 8.27E-02 5.13E-01 1.10E+00
Oral cancer 2B6E Oral tissue 2.68E-06 1.37E+00 1.38E+00
Ovarian cancer 2C73 Ovarian tissue 2.06E-02 -4.46E-01 -8.44E-01
Pancreatic cancer 2C10 Pancreas 6.95E-03 3.68E-01 7.02E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.52E-01 4.26E-01 9.92E-01
Pituitary cancer 2D12 Pituitary tissue 8.76E-01 -2.00E-01 -3.64E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.97E-01 -1.19E-01 -3.45E-01
Pompe disease 5C51.3 Biceps muscle 2.84E-02 3.08E-01 9.76E-01
Prostate cancer 2C82 Prostate 4.60E-02 8.63E-01 7.95E-01
Psoriasis EA90 Skin 1.79E-05 -1.53E-01 -3.93E-01
Rectal cancer 2B92 Rectal colon tissue 1.16E-09 -9.81E-01 -6.58E+00
Renal cancer 2C90-2C91 Kidney 1.41E-04 1.17E+00 1.72E+00
Retinoblastoma 2D02.2 Uvea 7.85E-12 2.45E+00 4.78E+00
Schizophrenia 6A20 Prefrontal cortex 2.44E-01 7.55E-02 5.80E-02
Schizophrenia 6A20 Superior temporal cortex 2.80E-01 8.42E-03 3.10E-02
Scleroderma 4A42.Z Whole blood 1.56E-01 -1.29E-01 -7.32E-01
Seizure 8A60-8A6Z Whole blood 1.93E-01 2.50E-01 4.89E-01
Sepsis with septic shock 1G41 Whole blood 5.96E-08 2.72E-01 6.10E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.50E-02 -5.18E-01 -6.68E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.70E-01 -8.66E-02 -5.54E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.98E-02 5.85E-01 1.73E+00
Skin cancer 2C30-2C3Z Skin 2.69E-03 7.10E-01 1.33E+00
Thrombocythemia 3B63 Whole blood 7.96E-01 -6.56E-02 -2.72E-01
Thrombocytopenia 3B64 Whole blood 3.17E-01 -4.49E-01 -5.03E-01
Thyroid cancer 2D10 Thyroid 7.35E-01 7.57E-02 1.58E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.39E-06 1.33E+00 2.81E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.77E-01 -1.53E-01 -1.28E+00
Type 2 diabetes 5A11 Liver tissue 6.88E-01 -1.33E-01 -2.67E-01
Ureter cancer 2C92 Urothelium 9.09E-01 2.00E-01 1.77E-01
Uterine cancer 2C78 Endometrium tissue 4.82E-01 2.36E-01 3.02E-01
Vitiligo ED63.0 Skin 2.58E-01 -1.97E-01 -6.09E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Transcriptional regulation of type 11 17beta-hydroxysteroid dehydrogenase expression in prostate cancer cells. Mol Cell Endocrinol. 2011 Jun 6;339(1-2):45-53.