General Information of Drug-Metabolizing Enzyme (DME) (ID: DEPJGQB)

DME Name Glucosamine-6-phosphate deaminase 2 (GNPDA2)
Synonyms Glucosamine-6-phosphate isomerase 2; Glucosamine-6-phosphate isomerase SB52; GlcN6P deaminase 2; GNP2; GNPDA 2; GNPDA2
Gene Name GNPDA2
UniProt ID
GNPI2_HUMAN
INTEDE ID
DME0522
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
132789
EC Number EC: 3.5.99.6
Hydrolases
Carbon-nitrogen hydrolase
Carbon-nitrogen hydrolase
EC: 3.5.99.6
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGH
LSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDA
FENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSK
VPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCD
EDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN
Function This enzyme catalyzes the deamination of the glucosamine-6-phosphate involved in the hexosamine signaling pathway.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Glycolysis (R-HSA-70171 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-glucosamine-phosphate DMPMYTE N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.51E-22 5.38E-01 1.23E+00
Alopecia ED70 Skin from scalp 6.93E-02 8.91E-02 2.34E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.77E-02 -2.81E-02 -1.10E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.67E-01 2.51E-02 6.66E-02
Aortic stenosis BB70 Calcified aortic valve 7.53E-01 5.09E-02 4.86E-02
Apnea 7A40 Hyperplastic tonsil 2.32E-01 -2.65E-01 -2.89E-01
Arthropathy FA00-FA5Z Peripheral blood 7.87E-02 -2.99E-01 -6.16E-01
Asthma CA23 Nasal and bronchial airway 9.48E-04 3.47E-01 5.89E-01
Atopic dermatitis EA80 Skin 2.96E-10 -6.71E-01 -1.88E+00
Autism 6A02 Whole blood 6.54E-01 1.49E-01 2.45E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.79E-02 2.60E-01 6.67E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.22E-01 1.89E-02 6.45E-02
Bacterial infection of gingival 1C1H Gingival tissue 2.12E-09 -3.34E-01 -7.85E-01
Batten disease 5C56.1 Whole blood 3.25E-01 -3.24E-01 -1.66E+00
Behcet's disease 4A62 Peripheral blood 5.54E-01 -1.02E-01 -4.53E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.52E-01 3.22E-02 1.80E-01
Bladder cancer 2C94 Bladder tissue 2.52E-05 -7.92E-01 -2.71E+00
Breast cancer 2C60-2C6Z Breast tissue 6.73E-35 -5.34E-01 -9.49E-01
Cardioembolic stroke 8B11.20 Whole blood 5.48E-01 -7.19E-02 -2.46E-01
Cervical cancer 2C77 Cervical tissue 7.97E-01 3.69E-02 1.03E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.63E-01 -2.09E-01 -1.70E-01
Chronic hepatitis C 1E51.1 Whole blood 9.70E-01 -1.18E-01 -3.07E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.84E-01 3.51E-03 1.13E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.82E-01 -1.47E-01 -3.29E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.96E-01 4.17E-02 9.01E-02
Colon cancer 2B90 Colon tissue 3.72E-08 2.81E-01 6.67E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.53E-01 9.22E-02 5.96E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.55E-01 6.25E-01 5.27E-01
Endometriosis GA10 Endometrium tissue 9.37E-01 3.23E-02 4.16E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.61E-01 6.30E-02 3.15E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.20E-01 -6.72E-02 -2.43E-01
Gastric cancer 2B72 Gastric tissue 5.83E-03 -2.30E-01 -3.49E+00
Glioblastopma 2A00.00 Nervous tissue 1.05E-29 2.70E-01 5.84E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.78E-02 1.21E+00 5.29E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.72E-01 5.72E-01 7.24E-01
Head and neck cancer 2D42 Head and neck tissue 1.05E-06 -3.01E-01 -5.93E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.66E-01 8.33E-02 2.25E-01
Huntington's disease 8A01.10 Whole blood 2.76E-01 -2.01E-01 -3.39E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.70E-01 1.07E-01 3.70E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.59E-03 -4.68E-01 -2.10E+00
Influenza 1E30 Whole blood 3.95E-02 -1.02E+00 -2.32E+00
Interstitial cystitis GC00.3 Bladder tissue 7.78E-01 -7.79E-02 -2.56E-01
Intracranial aneurysm 8B01.0 Intracranial artery 8.28E-02 -3.39E-01 -8.23E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.42E-01 4.47E-02 1.79E-01
Ischemic stroke 8B11 Peripheral blood 9.18E-01 4.87E-02 1.14E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.04E-01 -5.91E-02 -7.75E-02
Lateral sclerosis 8B60.4 Skin 9.43E-01 1.17E-01 2.78E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.53E-01 -2.65E-01 -2.88E-01
Liver cancer 2C12.0 Liver tissue 5.08E-03 2.72E-01 5.59E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.26E-01 -9.02E-02 -2.62E-01
Lung cancer 2C25 Lung tissue 4.18E-16 -3.04E-01 -6.51E-01
Lupus erythematosus 4A40 Whole blood 4.59E-01 2.71E-01 2.89E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.36E-01 9.30E-02 6.00E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.03E-01 -5.15E-03 -7.72E-03
Melanoma 2C30 Skin 1.65E-02 -2.21E-01 -3.34E-01
Multiple myeloma 2A83.1 Peripheral blood 6.21E-01 -2.19E-02 -9.33E-02
Multiple myeloma 2A83.1 Bone marrow 2.03E-04 6.37E-01 2.57E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.22E-01 -3.52E-01 -1.20E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.77E-01 -1.30E-01 -2.59E-01
Myelofibrosis 2A20.2 Whole blood 1.73E-02 -1.28E-01 -3.73E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.87E-02 -5.17E-01 -5.52E-01
Myopathy 8C70.6 Muscle tissue 9.54E-02 2.26E-01 7.12E-01
Neonatal sepsis KA60 Whole blood 1.19E-10 -7.68E-01 -1.08E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.54E-04 9.55E-01 1.93E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.92E-01 0.00E+00 0.00E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.36E-02 -3.15E-01 -1.43E+00
Olive pollen allergy CA08.00 Peripheral blood 7.36E-02 -5.69E-01 -3.81E+00
Oral cancer 2B6E Oral tissue 2.77E-03 4.99E-01 8.24E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.74E-01 6.81E-01 9.39E-01
Osteoporosis FB83.1 Bone marrow 3.96E-02 -4.90E-01 -2.13E+00
Ovarian cancer 2C73 Ovarian tissue 2.84E-01 -2.80E-01 -3.78E-01
Pancreatic cancer 2C10 Pancreas 5.34E-03 5.68E-01 1.12E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.46E-03 -4.74E-01 -1.53E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.06E-02 -2.35E-01 -7.22E-01
Pituitary cancer 2D12 Pituitary tissue 7.07E-02 1.78E-01 4.04E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.12E-02 3.24E-01 1.15E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.41E-01 -9.21E-02 -3.20E-01
Polycythemia vera 2A20.4 Whole blood 9.39E-03 -1.11E-01 -3.20E-01
Pompe disease 5C51.3 Biceps muscle 3.39E-01 -1.97E-02 -7.04E-02
Preterm birth KA21.4Z Myometrium 9.59E-01 -6.24E-02 -4.84E-02
Prostate cancer 2C82 Prostate 2.72E-03 1.26E+00 1.29E+00
Psoriasis EA90 Skin 1.27E-02 1.29E-01 2.56E-01
Rectal cancer 2B92 Rectal colon tissue 8.51E-02 -3.13E-01 -1.01E+00
Renal cancer 2C90-2C91 Kidney 1.42E-02 3.11E-01 7.01E-01
Retinoblastoma 2D02.2 Uvea 4.07E-02 -1.29E-01 -5.27E-01
Rheumatoid arthritis FA20 Synovial tissue 7.50E-04 6.50E-01 1.31E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.79E-01 2.51E-02 9.35E-02
Schizophrenia 6A20 Prefrontal cortex 8.18E-02 -8.29E-02 -2.34E-01
Schizophrenia 6A20 Superior temporal cortex 3.15E-01 2.95E-02 1.66E-01
Scleroderma 4A42.Z Whole blood 5.08E-04 -5.96E-01 -2.07E+00
Seizure 8A60-8A6Z Whole blood 4.81E-01 -1.83E-02 -3.10E-02
Sensitive skin EK0Z Skin 7.14E-01 7.03E-02 4.40E-01
Sepsis with septic shock 1G41 Whole blood 4.07E-49 -1.20E+00 -1.96E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.44E-01 1.37E-01 2.78E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.26E-01 1.01E-01 1.77E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.66E-01 -6.06E-01 -6.99E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.02E-03 3.65E-01 5.18E+00
Skin cancer 2C30-2C3Z Skin 1.33E-01 -2.14E-01 -4.17E-01
Thrombocythemia 3B63 Whole blood 3.58E-02 -2.34E-03 -6.59E-03
Thrombocytopenia 3B64 Whole blood 3.43E-01 -2.92E-01 -2.26E-01
Thyroid cancer 2D10 Thyroid 5.01E-11 -3.57E-01 -9.40E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.07E-02 4.05E-01 7.65E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.64E-03 -6.13E-01 -5.66E+00
Type 2 diabetes 5A11 Liver tissue 8.60E-01 -3.79E-02 -8.55E-02
Ureter cancer 2C92 Urothelium 6.91E-01 3.75E-02 2.29E-01
Uterine cancer 2C78 Endometrium tissue 9.91E-05 -1.88E-01 -3.24E-01
Vitiligo ED63.0 Skin 3.37E-01 6.49E-02 2.78E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Allosteric kinetics of the isoform 1 of human glucosamine-6-phosphate deaminase. Biochim Biophys Acta. 2011 Dec;1814(12):1846-53.