General Information of Drug-Metabolizing Enzyme (DME) (ID: DEPLH5Z)

DME Name Phosphoenolpyruvate carboxykinase (PCK1)
Synonyms Phosphoenolpyruvate carboxykinase [GTP]; Cytosolic phosphoenolpyruvate carboxykinase [GTP]; PCK1; PEPCK-C; PEPCK1
Gene Name PCK1
UniProt ID
PCKGC_HUMAN
INTEDE ID
DME0496
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5105
EC Number EC: 4.1.1.32
Lyases
Carbon-carbon lyase
Carboxy-lyase
EC: 4.1.1.32
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQM
EEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPV
LEAVGDGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNPSL
PGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAW
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPF
AMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWM
FNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQV
NADLPCEIEREILALKQRISQM
Function
This enzyme catalyzes the cataplerotic conversion of oxaloacetate (OAA) to phosphoenolpyruvate (PEP), the rate-limiting step in the metabolic pathway that produces glucose from lactate and other precursors derived from the citric acid cycle and it also catalyzes the anaplerotic conversion of phosphoenolpyruvate to oxaloacetate.
KEGG Pathway
AMPK signaling pathway (hsa04152 )
Adipocytokine signaling pathway (hsa04920 )
Citrate cycle (TCA cycle) (hsa00020 )
FoxO signaling pathway (hsa04068 )
Glucagon signaling pathway (hsa04922 )
Glycolysis / Gluconeogenesis (hsa00010 )
Insulin resistance (hsa04931 )
Insulin signaling pathway (hsa04910 )
Metabolic pathways (hsa01100 )
PI3K-Akt signaling pathway (hsa04151 )
PPAR signaling pathway (hsa03320 )
Proximal tubule bicarbonate reclamation (hsa04964 )
Pyruvate metabolism (hsa00620 )
Reactome Pathway
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes (R-HSA-9615017 )
Gluconeogenesis (R-HSA-70263 )
NR1H2 & NR1H3 regulate gene expression linked to gluconeogenesis (R-HSA-9632974 )
Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )
Abacavir metabolism (R-HSA-2161541 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
oxalacetic acid DMPZSV1 Discovery agent N.A. Investigative [1]
Phosphoenolpyruvate DM2D947 Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
oxalacetic acid Discovery agent [N.A.] Investigative Km = 0.033 microM [1]
Phosphoenolpyruvate Discovery agent [N.A.] Investigative Km = 0.036 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.12E-06 -6.52E-02 -4.13E-01
Alopecia ED70 Skin from scalp 1.62E-02 8.80E-02 7.88E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.42E-03 2.23E-01 3.80E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.99E-01 -1.54E-03 -1.72E-02
Aortic stenosis BB70 Calcified aortic valve 4.04E-02 -4.76E-01 -4.13E-01
Apnea 7A40 Hyperplastic tonsil 5.67E-01 -8.82E-02 -5.90E-01
Arthropathy FA00-FA5Z Peripheral blood 7.94E-01 -1.90E-03 -1.47E-02
Asthma CA23 Nasal and bronchial airway 1.02E-01 -5.33E-02 -2.47E-01
Atopic dermatitis EA80 Skin 1.07E-01 -1.21E+00 -6.66E-01
Autism 6A02 Whole blood 4.58E-01 -5.42E-02 -3.44E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.99E-01 2.09E-02 1.06E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.22E-01 7.34E-03 7.46E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.52E-01 -4.06E-02 -3.68E-01
Batten disease 5C56.1 Whole blood 6.72E-01 -4.40E-02 -2.21E-01
Behcet's disease 4A62 Peripheral blood 5.92E-01 7.68E-02 4.52E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.73E-01 7.36E-02 1.34E-01
Bladder cancer 2C94 Bladder tissue 6.86E-01 1.96E-01 2.76E-01
Breast cancer 2C60-2C6Z Breast tissue 6.84E-67 -4.11E+00 -1.80E+00
Cardioembolic stroke 8B11.20 Whole blood 5.82E-01 -1.06E-02 -6.47E-02
Cervical cancer 2C77 Cervical tissue 1.43E-02 2.55E-02 1.89E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.89E-01 -5.28E-02 -2.69E-01
Chronic hepatitis C 1E51.1 Whole blood 2.93E-01 -8.53E-02 -6.92E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.07E-01 -3.73E-03 -1.53E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.70E-02 -7.82E-02 -5.67E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.46E-01 5.79E-03 3.99E-02
Colon cancer 2B90 Colon tissue 1.30E-126 -3.24E+00 -3.83E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.18E-01 -7.32E-02 -1.38E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.71E-01 2.07E-02 9.06E-02
Endometriosis GA10 Endometrium tissue 5.04E-03 1.35E-01 5.68E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.83E-01 -3.66E-02 -2.53E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.06E-02 -1.44E-01 -7.42E-01
Gastric cancer 2B72 Gastric tissue 1.29E-03 1.85E+00 6.60E+00
Glioblastopma 2A00.00 Nervous tissue 2.57E-11 -1.87E-01 -3.03E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.55E-01 3.28E-01 1.66E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.07E-01 -2.95E-01 -2.72E-01
Head and neck cancer 2D42 Head and neck tissue 1.40E-01 -9.10E-02 -2.10E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.39E-02 1.36E-01 5.61E-01
Huntington's disease 8A01.10 Whole blood 5.19E-01 4.20E-02 3.93E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.89E-01 -1.05E-01 -4.78E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.95E-01 5.36E-02 5.28E-01
Influenza 1E30 Whole blood 1.56E-02 3.20E-01 2.88E+00
Interstitial cystitis GC00.3 Bladder tissue 4.01E-01 1.03E-02 2.37E-02
Intracranial aneurysm 8B01.0 Intracranial artery 2.81E-03 -1.03E+00 -7.08E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.96E-01 4.55E-02 9.64E-02
Ischemic stroke 8B11 Peripheral blood 1.67E-01 1.13E-01 5.49E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.56E-01 3.65E-02 1.34E-01
Lateral sclerosis 8B60.4 Skin 6.62E-01 3.03E-02 1.69E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.39E-01 6.87E-02 1.87E-01
Liver cancer 2C12.0 Liver tissue 3.30E-14 -1.82E+00 -1.55E+00
Liver failure DB99.7-DB99.8 Liver tissue 9.36E-02 -2.71E+00 -3.28E+00
Lung cancer 2C25 Lung tissue 3.86E-15 1.42E-01 2.71E-01
Lupus erythematosus 4A40 Whole blood 9.64E-01 -1.27E-02 -4.74E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.91E-01 6.13E-02 1.38E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.19E-01 -7.75E-03 -3.45E-02
Melanoma 2C30 Skin 1.65E-03 -2.26E+00 -1.25E+00
Multiple myeloma 2A83.1 Peripheral blood 6.65E-02 5.12E-02 5.26E-01
Multiple myeloma 2A83.1 Bone marrow 7.59E-01 -5.48E-02 -8.82E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.24E-01 -3.31E-02 -7.02E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.27E-02 6.63E-02 5.11E-01
Myelofibrosis 2A20.2 Whole blood 7.36E-01 1.68E-02 1.80E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.02E-02 -7.61E-02 -1.21E-01
Myopathy 8C70.6 Muscle tissue 2.20E-02 2.42E-01 8.73E-01
Neonatal sepsis KA60 Whole blood 2.28E-01 2.91E-02 2.06E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.14E-04 4.98E-02 2.30E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.48E-01 -1.28E-01 -3.68E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.11E-02 1.37E+00 1.71E+00
Olive pollen allergy CA08.00 Peripheral blood 5.67E-01 8.34E-03 7.33E-02
Oral cancer 2B6E Oral tissue 2.16E-03 -3.90E-01 -5.41E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.18E-01 -2.82E+00 -1.15E+00
Osteoporosis FB83.1 Bone marrow 6.98E-01 -4.11E-02 -5.53E-01
Ovarian cancer 2C73 Ovarian tissue 2.37E-02 5.72E-01 5.51E-01
Pancreatic cancer 2C10 Pancreas 3.57E-01 -8.07E-01 -3.77E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.17E-01 3.22E-01 6.72E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.07E-01 -2.95E-02 -1.64E-01
Pituitary cancer 2D12 Pituitary tissue 5.67E-10 -6.44E+00 -6.70E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.79E-09 -6.65E+00 -7.48E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.37E-01 1.00E-01 2.23E-01
Polycythemia vera 2A20.4 Whole blood 1.28E-03 3.61E-02 3.59E-01
Pompe disease 5C51.3 Biceps muscle 5.75E-02 -1.55E-01 -6.82E-01
Preterm birth KA21.4Z Myometrium 3.26E-01 4.25E-02 1.96E-01
Prostate cancer 2C82 Prostate 1.82E-01 -2.43E-01 -1.35E-01
Psoriasis EA90 Skin 1.63E-08 -1.25E+00 -9.77E-01
Rectal cancer 2B92 Rectal colon tissue 1.15E-14 -2.78E+00 -7.69E+00
Renal cancer 2C90-2C91 Kidney 3.89E-04 -4.64E+00 -2.03E+00
Retinoblastoma 2D02.2 Uvea 4.24E-03 -3.98E-01 -5.73E-01
Rheumatoid arthritis FA20 Synovial tissue 3.31E-05 -4.24E+00 -4.52E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.19E-01 6.88E-02 6.54E-01
Schizophrenia 6A20 Prefrontal cortex 3.77E-01 -5.56E-04 -1.23E-03
Schizophrenia 6A20 Superior temporal cortex 7.29E-01 -8.89E-03 -5.37E-02
Scleroderma 4A42.Z Whole blood 1.71E-04 3.00E-01 2.02E+00
Seizure 8A60-8A6Z Whole blood 1.10E-01 -1.56E-01 -8.60E-01
Sensitive skin EK0Z Skin 9.53E-01 -2.80E-01 -3.22E-01
Sepsis with septic shock 1G41 Whole blood 4.26E-02 4.84E-02 3.12E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.34E-01 2.03E-01 1.05E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.72E-01 5.90E-02 7.46E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.95E-01 -2.49E-01 -2.18E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.95E-01 -8.14E-02 -2.07E-01
Skin cancer 2C30-2C3Z Skin 6.80E-43 -2.00E+00 -1.31E+00
Thrombocythemia 3B63 Whole blood 1.48E-01 -6.62E-04 -6.55E-03
Thrombocytopenia 3B64 Whole blood 3.66E-01 3.49E+00 1.51E+00
Thyroid cancer 2D10 Thyroid 3.84E-02 -1.65E-01 -3.82E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.41E-01 4.22E-01 5.44E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.76E-01 -6.58E-02 -1.42E+00
Type 2 diabetes 5A11 Liver tissue 6.20E-01 3.22E-01 4.07E-01
Ureter cancer 2C92 Urothelium 3.70E-01 -2.48E-02 -7.70E-02
Uterine cancer 2C78 Endometrium tissue 1.82E-14 2.78E-01 5.01E-01
Vitiligo ED63.0 Skin 7.58E-01 -2.70E-01 -1.28E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Tyr235 of human cytosolic phosphoenolpyruvate carboxykinase influences catalysis through an anion-quadrupole interaction with phosphoenolpyruvate carboxylate. FEBS J. 2008 Dec;275(23):5810-9.