Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEPT1ME)

DME Name Gamma-glutamyltranspeptidase 1 (GGT1)
Synonyms Glutathione hydrolase 1 proenzyme; Leukotriene-C4 hydrolase; Gamma-glutamyltransferase 1; Glutathione hydrolase 1 heavy chain; Glutathione hydrolase 1 light chain; CD224; GGT; GGT 1; GGT1
Gene Name GGT1
UniProt ID
GGT1_HUMAN
INTEDE ID
DME0498
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2678
EC Number EC: 3.4.19.13
Hydrolases
Peptidase
Omega peptidase
EC: 3.4.19.13
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRD
GGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFN
SSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALEN
KRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKD
IQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFSR
ESVESPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRAQISD
DTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNE
MDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTA
TALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTF
IAVVQAIVRTAGGWAAASDSRKGGEPAGY
Function
This enzyme cleaves the gamma-glutamyl bond of extracellular glutathione (gamma-Glu-Cys-Gly), glutathione conjugates, and other gamma-glutamyl compounds. The metabolism of glutathione releases free glutamate and the dipeptide cysteinyl-glycine, which is hydrolyzed to cysteine and glycine by dipeptidases. In the presence of high concentrations of dipeptides and some amino acids, it can also catalyze a transpeptidation reaction, transferring the gamma-glutamyl moiety to an acceptor amino acid to form a new gamma-glutamyl compound.
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Glutathione metabolism (hsa00480 )
Metabolic pathways (hsa01100 )
Taurine and hypotaurine metabolism (hsa00430 )
Reactome Pathway
Defective GGT1 causes Glutathionuria (GLUTH) (R-HSA-5579022 )
Defective GGT1 causes Glutathionuria (GLUTH) (R-HSA-9035968 )
Glutathione synthesis and recycling (R-HSA-174403 )
Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691 )
Aflatoxin activation and detoxification (R-HSA-5423646 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
2 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Glutathione ester DMAV2I7 N. A. N. A. Investigative [1]
LTC4 DM702WR Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
LTC4 Discovery agent [N.A.] Investigative Km = 0.0102 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.56E-01 -2.39E-02 -1.07E-01
Alopecia ED70 Skin from scalp 1.23E-03 -1.90E-01 -7.20E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.29E-02 6.79E-02 3.91E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.59E-01 -5.13E-02 -2.77E-01
Aortic stenosis BB70 Calcified aortic valve 2.51E-01 3.82E-03 2.11E-02
Apnea 7A40 Hyperplastic tonsil 3.51E-01 -2.02E-01 -6.37E-01
Arthropathy FA00-FA5Z Peripheral blood 4.75E-01 1.17E-02 8.12E-02
Asthma CA23 Nasal and bronchial airway 8.12E-04 -1.99E-01 -3.88E-01
Atopic dermatitis EA80 Skin 6.69E-11 2.56E-01 2.54E+00
Autism 6A02 Whole blood 7.36E-02 -5.91E-02 -2.62E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.84E-02 -1.34E-01 -6.41E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.99E-02 2.66E-01 1.37E+00
Bacterial infection of gingival 1C1H Gingival tissue 8.96E-02 -1.35E-01 -3.80E-01
Batten disease 5C56.1 Whole blood 3.87E-02 -2.26E-01 -1.54E+00
Behcet's disease 4A62 Peripheral blood 3.95E-02 1.21E-01 7.39E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.14E-01 -5.16E-02 -2.47E-01
Bladder cancer 2C94 Bladder tissue 1.97E-04 7.43E-01 3.19E+00
Breast cancer 2C60-2C6Z Breast tissue 1.32E-02 -9.11E-02 -2.71E-01
Cardioembolic stroke 8B11.20 Whole blood 9.45E-01 4.70E-02 1.51E-01
Cervical cancer 2C77 Cervical tissue 1.13E-01 -3.43E-02 -1.45E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.45E-01 6.59E-02 2.60E-01
Chronic hepatitis C 1E51.1 Whole blood 1.35E-03 1.64E-01 1.43E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 7.37E-02 2.14E-01 5.62E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.02E-01 3.29E-02 1.20E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.89E-01 1.68E-02 1.30E-01
Colon cancer 2B90 Colon tissue 2.85E-01 -4.87E-02 -1.69E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.73E-01 8.40E-02 1.79E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.56E-01 -1.19E-01 -5.53E-01
Endometriosis GA10 Endometrium tissue 9.70E-01 -4.88E-02 -1.12E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.20E-01 -3.52E-02 -2.39E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.67E-03 -3.09E-01 -1.19E+00
Gastric cancer 2B72 Gastric tissue 1.86E-01 -3.67E-01 -1.06E+00
Glioblastopma 2A00.00 Nervous tissue 1.32E-02 -3.11E-02 -8.22E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.99E-01 -2.39E-01 -5.46E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.47E-02 -5.30E-01 -1.15E+00
Head and neck cancer 2D42 Head and neck tissue 6.18E-03 8.96E-02 3.10E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.93E-01 -7.40E-03 -3.53E-02
Huntington's disease 8A01.10 Whole blood 1.05E-01 1.05E-01 6.95E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.98E-02 -1.41E-01 -7.42E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.84E-01 -1.75E-02 -2.88E-01
Influenza 1E30 Whole blood 8.38E-03 9.50E-01 4.24E+00
Interstitial cystitis GC00.3 Bladder tissue 3.50E-01 8.90E-02 1.80E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.81E-01 1.73E-02 8.75E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.24E-01 1.17E-01 3.52E-01
Ischemic stroke 8B11 Peripheral blood 5.40E-02 6.41E-02 3.14E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.83E-01 1.12E-02 4.16E-02
Lateral sclerosis 8B60.4 Skin 9.93E-01 8.71E-02 1.05E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 1.36E-01 2.43E-02 1.12E-01
Liver cancer 2C12.0 Liver tissue 5.86E-04 -1.41E-01 -5.60E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.92E-01 9.70E-02 3.05E-01
Lung cancer 2C25 Lung tissue 2.15E-05 1.22E-01 4.14E-01
Lupus erythematosus 4A40 Whole blood 5.39E-01 -1.02E-01 -1.52E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.61E-01 -2.11E-02 -1.08E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.77E-01 1.13E-02 3.14E-02
Melanoma 2C30 Skin 2.20E-01 2.09E-01 2.52E-01
Multiple myeloma 2A83.1 Peripheral blood 1.25E-01 1.27E-01 8.63E-01
Multiple myeloma 2A83.1 Bone marrow 2.41E-05 -5.88E-01 -3.39E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.02E-01 2.18E-03 8.39E-03
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.74E-02 -8.13E-02 -3.71E-01
Myelofibrosis 2A20.2 Whole blood 2.55E-03 -7.41E-02 -6.35E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.79E-01 2.08E-01 3.39E-01
Myopathy 8C70.6 Muscle tissue 2.69E-03 -3.19E-01 -2.08E+00
Neonatal sepsis KA60 Whole blood 8.44E-01 1.91E-02 7.33E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.08E-05 -1.55E+00 -2.66E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.93E-01 -3.75E-02 -2.40E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.30E-01 2.26E-02 2.30E-01
Olive pollen allergy CA08.00 Peripheral blood 4.96E-01 6.71E-02 1.34E-01
Oral cancer 2B6E Oral tissue 1.89E-02 -2.71E-01 -4.96E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.67E-02 -5.90E-01 -1.30E+00
Osteoporosis FB83.1 Bone marrow 4.46E-01 -8.15E-03 -1.93E-01
Ovarian cancer 2C73 Ovarian tissue 1.40E-01 -2.28E-01 -6.64E-01
Pancreatic cancer 2C10 Pancreas 6.28E-03 -2.95E-01 -7.93E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.86E-01 9.88E-02 4.04E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.42E-01 -1.32E-01 -6.70E-01
Pituitary cancer 2D12 Pituitary tissue 6.90E-02 -1.87E-01 -4.71E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.89E-01 -7.84E-02 -2.88E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.96E-01 6.24E-03 3.72E-02
Polycythemia vera 2A20.4 Whole blood 1.04E-01 -6.21E-03 -4.94E-02
Pompe disease 5C51.3 Biceps muscle 1.49E-03 -2.89E-01 -2.71E+00
Preterm birth KA21.4Z Myometrium 2.38E-01 -1.25E-01 -5.37E-01
Prostate cancer 2C82 Prostate 4.92E-04 -1.52E+00 -1.26E+00
Psoriasis EA90 Skin 3.27E-05 -2.01E-01 -4.88E-01
Rectal cancer 2B92 Rectal colon tissue 4.93E-02 9.99E-02 5.62E-01
Renal cancer 2C90-2C91 Kidney 6.42E-02 -2.40E-01 -6.25E-01
Retinoblastoma 2D02.2 Uvea 3.53E-04 -4.36E-01 -1.92E+00
Rheumatoid arthritis FA20 Synovial tissue 6.49E-04 -1.11E+00 -2.32E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.56E-01 -3.55E-02 -2.91E-01
Schizophrenia 6A20 Prefrontal cortex 1.21E-01 7.26E-02 1.98E-01
Schizophrenia 6A20 Superior temporal cortex 7.90E-01 -1.76E-02 -2.06E-01
Scleroderma 4A42.Z Whole blood 2.87E-02 -2.37E-01 -1.27E+00
Seizure 8A60-8A6Z Whole blood 1.51E-01 -6.31E-02 -3.97E-01
Sensitive skin EK0Z Skin 1.98E-01 4.44E-02 3.88E-01
Sepsis with septic shock 1G41 Whole blood 2.27E-03 6.11E-02 2.41E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.14E-01 1.37E-01 4.86E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.45E-01 -1.53E-01 -6.11E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.92E-01 3.33E-02 1.24E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.65E-01 4.58E-04 3.90E-03
Skin cancer 2C30-2C3Z Skin 3.62E-01 2.02E-02 4.04E-02
Thrombocythemia 3B63 Whole blood 7.75E-01 1.83E-02 1.57E-01
Thrombocytopenia 3B64 Whole blood 5.73E-01 -6.29E-02 -2.47E-01
Thyroid cancer 2D10 Thyroid 1.43E-03 1.11E-01 3.46E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.26E-01 -1.11E-01 -6.47E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.00E-01 3.41E-01 2.43E+00
Type 2 diabetes 5A11 Liver tissue 5.34E-01 2.94E-02 1.73E-01
Ureter cancer 2C92 Urothelium 1.62E-01 -1.20E-01 -3.45E-01
Uterine cancer 2C78 Endometrium tissue 7.68E-03 -1.75E-01 -4.70E-01
Vitiligo ED63.0 Skin 6.41E-01 1.01E-02 7.38E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Leukotriene-C4 hydrolase DTT Info

References

1 Gamma-glutamyl compounds: substrate specificity of gamma-glutamyl transpeptidase enzymes. Anal Biochem. 2011 Jul 15;414(2):208-14.