Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEPTKBQ)

DME Name Tryptophanyl-tRNA synthetase mitochondrial (WARS2)
Synonyms Mitochondrial tryptophan--tRNA ligase; Mitochondrial tryptophan-tRNA ligase; (Mt)TrpRS; WARS2
Gene Name WARS2
UniProt ID
SYWM_HUMAN
INTEDE ID
DME0176
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
10352
EC Number EC: 6.1.1.2
Ligase
Carbon-oxygen ligase
Aminoacyl tRNA synthetase
EC: 6.1.1.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MALHSMRKARERWSFIRALHKGSAAAPALQKDSKKRVFSGIQPTGILHLGNYLGAIESWV
RLQDEYDSVLYSIVDLHSITVPQDPAVLRQSILDMTAVLLACGINPEKSILFQQSQVSEH
TQLSWILSCMVRLPRLQHLHQWKAKTTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGE
DQVQHMELVQDLAQGFNKKYGEFFPVPESILTSMKKVKSLRDPSAKMSKSDPDKLATVRI
TDSPEEIVQKFRKAVTDFTSEVTYDPAGRAGVSNIVAVHAAVTGLSVEEVVRRSAGMNTA
RYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVGFL
Function This enzyme activates and transfers the amino acids to their corresponding tRNAs during the translation of mitochondrial genes and protein synthesis.
KEGG Pathway
Aminoacyl-tRNA biosynthesis (hsa00970 )
Reactome Pathway
Mitochondrial tRNA aminoacylation (R-HSA-379726 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Tryptophan DMIBH7M Depression 6A70-6A7Z Approved [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
L-Tryptophan Depression [6A70-6A7Z] Approved Km = 0.027 microM [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.31E-06 2.03E-01 5.60E-01
Alopecia ED70 Skin from scalp 6.10E-01 9.40E-02 2.72E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.65E-01 -4.34E-02 -1.55E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.38E-01 2.51E-01 7.17E-01
Aortic stenosis BB70 Calcified aortic valve 9.17E-01 1.68E-01 1.83E-01
Apnea 7A40 Hyperplastic tonsil 5.08E-01 -2.45E-01 -1.08E+00
Arthropathy FA00-FA5Z Peripheral blood 7.35E-02 -1.71E-01 -6.19E-01
Asthma CA23 Nasal and bronchial airway 1.01E-06 4.74E-01 6.84E-01
Atopic dermatitis EA80 Skin 1.66E-01 -1.23E-01 -6.05E-01
Autism 6A02 Whole blood 2.27E-01 2.08E-02 1.07E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.66E-01 -2.35E-01 -5.62E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.15E-01 -6.72E-02 -2.71E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.47E-06 -2.12E-01 -5.20E-01
Batten disease 5C56.1 Whole blood 4.40E-01 -2.12E-01 -9.27E-01
Behcet's disease 4A62 Peripheral blood 9.36E-01 5.47E-02 1.54E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.53E-01 9.40E-02 3.04E-01
Bladder cancer 2C94 Bladder tissue 3.69E-06 -1.11E+00 -3.89E+00
Breast cancer 2C60-2C6Z Breast tissue 4.06E-09 1.54E-01 2.67E-01
Cardioembolic stroke 8B11.20 Whole blood 1.03E-01 3.32E-01 3.59E-01
Cervical cancer 2C77 Cervical tissue 6.09E-01 1.32E-02 2.94E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.51E-01 -2.72E-01 -3.20E-01
Chronic hepatitis C 1E51.1 Whole blood 5.84E-01 2.10E-01 3.13E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.77E-01 -1.06E-01 -2.56E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.65E-01 -1.36E-01 -3.22E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.12E-01 -1.50E-01 -5.23E-01
Colon cancer 2B90 Colon tissue 4.68E-03 5.86E-02 1.14E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.25E-01 -1.03E-01 -6.57E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.56E-01 5.53E-05 1.35E-04
Endometriosis GA10 Endometrium tissue 1.93E-02 -5.77E-01 -7.25E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.92E-01 6.18E-02 2.45E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.57E-04 6.54E-01 1.76E+00
Gastric cancer 2B72 Gastric tissue 1.48E-01 1.08E+00 1.26E+00
Glioblastopma 2A00.00 Nervous tissue 4.20E-51 4.42E-01 1.05E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.34E-04 3.30E-01 2.86E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.56E-02 5.47E-01 8.53E-01
Head and neck cancer 2D42 Head and neck tissue 2.25E-01 -7.58E-02 -1.72E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.72E-01 -1.12E-01 -4.19E-01
Huntington's disease 8A01.10 Whole blood 1.18E-01 -1.66E-01 -1.05E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.14E-01 -8.94E-03 -3.32E-02
Immunodeficiency 4A00-4A20 Peripheral blood 1.10E-01 7.14E-02 3.14E-01
Influenza 1E30 Whole blood 3.14E-04 -1.69E+00 -5.58E+01
Interstitial cystitis GC00.3 Bladder tissue 5.05E-03 -7.40E-01 -2.32E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.06E-01 -1.94E-01 -1.54E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.54E-01 -6.33E-02 -1.29E-01
Ischemic stroke 8B11 Peripheral blood 7.07E-01 -6.75E-02 -2.07E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.05E-01 -5.84E-02 -9.58E-02
Lateral sclerosis 8B60.4 Skin 4.15E-01 1.33E-01 1.18E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 2.54E-01 -1.04E-01 -3.44E-01
Liver cancer 2C12.0 Liver tissue 3.99E-08 3.02E-01 8.09E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.07E-02 4.39E-01 1.61E+00
Lung cancer 2C25 Lung tissue 6.86E-04 2.35E-02 5.97E-02
Lupus erythematosus 4A40 Whole blood 6.23E-01 7.31E-02 1.25E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.26E-01 -6.74E-03 -2.15E-02
Major depressive disorder 6A70-6A7Z Whole blood 8.48E-01 -4.35E-02 -7.39E-02
Melanoma 2C30 Skin 8.24E-01 -5.41E-02 -7.10E-02
Multiple myeloma 2A83.1 Peripheral blood 3.42E-01 -7.10E-01 -1.02E+00
Multiple myeloma 2A83.1 Bone marrow 1.32E-06 6.43E-01 3.73E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.93E-01 -1.02E-01 -1.62E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.27E-01 -4.28E-02 -9.08E-02
Myelofibrosis 2A20.2 Whole blood 2.57E-01 -1.34E-01 -5.28E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.81E-02 -4.20E-01 -5.08E-01
Myopathy 8C70.6 Muscle tissue 2.37E-01 -2.39E-03 -5.85E-03
Neonatal sepsis KA60 Whole blood 4.90E-11 -3.71E-01 -1.40E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.47E-07 1.53E+00 3.28E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.09E-01 1.73E-01 8.33E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.33E-02 -6.70E-01 -1.07E+00
Olive pollen allergy CA08.00 Peripheral blood 2.94E-01 -2.37E-01 -2.83E-01
Oral cancer 2B6E Oral tissue 3.51E-06 6.52E-01 1.46E+00
Osteoarthritis FA00-FA0Z Synovial tissue 7.41E-01 -8.18E-02 -2.11E-01
Osteoporosis FB83.1 Bone marrow 2.80E-01 -2.52E-01 -7.85E-01
Ovarian cancer 2C73 Ovarian tissue 2.45E-02 4.08E-01 7.36E-01
Pancreatic cancer 2C10 Pancreas 2.91E-01 -1.89E-01 -3.46E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.74E-01 -1.70E-01 -7.10E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.96E-01 -6.73E-02 -1.56E-01
Pituitary cancer 2D12 Pituitary tissue 1.97E-01 -5.68E-01 -1.05E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.34E-01 -4.83E-01 -1.19E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.21E-01 5.53E-03 3.32E-02
Polycythemia vera 2A20.4 Whole blood 2.82E-09 -3.59E-01 -1.27E+00
Pompe disease 5C51.3 Biceps muscle 7.65E-01 -1.88E-02 -5.46E-02
Preterm birth KA21.4Z Myometrium 4.64E-01 3.29E-02 5.17E-02
Prostate cancer 2C82 Prostate 4.97E-02 2.13E-01 2.05E-01
Psoriasis EA90 Skin 5.07E-01 6.51E-02 1.30E-01
Rectal cancer 2B92 Rectal colon tissue 6.28E-01 1.50E-01 5.18E-01
Renal cancer 2C90-2C91 Kidney 3.70E-02 6.55E-01 1.07E+00
Retinoblastoma 2D02.2 Uvea 6.22E-03 6.47E-01 2.46E+00
Rheumatoid arthritis FA20 Synovial tissue 5.08E-02 2.32E-01 3.28E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.46E-01 7.90E-03 3.27E-02
Schizophrenia 6A20 Prefrontal cortex 6.89E-01 -1.44E-02 -2.47E-02
Schizophrenia 6A20 Superior temporal cortex 6.15E-01 3.29E-02 2.06E-01
Scleroderma 4A42.Z Whole blood 1.65E-03 2.85E-01 1.66E+00
Seizure 8A60-8A6Z Whole blood 8.12E-01 1.36E-01 4.97E-01
Sensitive skin EK0Z Skin 2.12E-01 -6.74E-02 -2.70E-01
Sepsis with septic shock 1G41 Whole blood 3.93E-23 -2.94E-01 -1.15E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.36E-01 -5.40E-01 -9.11E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.15E-03 -1.25E-01 -1.48E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.22E-01 -2.98E-02 -1.25E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.74E-01 -8.95E-02 -2.06E-01
Skin cancer 2C30-2C3Z Skin 9.76E-04 -1.97E-01 -4.13E-01
Thrombocythemia 3B63 Whole blood 2.60E-05 -4.20E-01 -1.61E+00
Thrombocytopenia 3B64 Whole blood 7.28E-01 1.65E-01 2.33E-01
Thyroid cancer 2D10 Thyroid 2.03E-01 -9.33E-02 -2.55E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.43E-01 1.00E-01 3.59E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.78E-01 -9.21E-02 -3.41E-01
Type 2 diabetes 5A11 Liver tissue 2.61E-01 5.44E-01 1.05E+00
Ureter cancer 2C92 Urothelium 5.74E-01 5.55E-02 3.37E-01
Uterine cancer 2C78 Endometrium tissue 9.92E-01 -5.74E-02 -1.05E-01
Vitiligo ED63.0 Skin 2.10E-03 -2.07E-01 -1.73E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Crystal structure of tryptophanyl-tRNA synthetase complexed with adenosine-5' tetraphosphate: evidence for distributed use of catalytic binding energy in amino acid activation by class I aminoacyl-tRNA synthetases. J Mol Biol. 2007 May 25;369(1):108-28.
2 Identification and characterization of human mitochondrial tryptophanyl-tRNA synthetase. J Biol Chem. 2000 Jun 2;275(22):16820-6.