Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEQG7F9)

DME Name Lactate dehydrogenase C (LDHC)
Synonyms L-lactate dehydrogenase C chain; LDH testis subunit; Cancer/testis antigen 32; LDH-C; LDH-X; LDH3; LDHC; LDHX; CT32
Gene Name LDHC
UniProt ID
LDHC_HUMAN
INTEDE ID
DME0503
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
3948
EC Number EC: 1.1.1.27
Oxidoreductase
CH-OH donor oxidoreductase
NAD/NADP oxidoreductase
EC: 1.1.1.27
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKG
EMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSI
IPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGV
HPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYE
IIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGV
SDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Function This enzyme catalyzes the conversion of lactate to pyruvate and back, as it converts NAD+ to NADH and back.
KEGG Pathway
Central carbon metabolism in cancer (hsa05230 )
Cysteine and methionine metabolism (hsa00270 )
Glucagon signaling pathway (hsa04922 )
Glycolysis / Gluconeogenesis (hsa00010 )
HIF-1 signaling pathway (hsa04066 )
Metabolic pathways (hsa01100 )
Propanoate metabolism (hsa00640 )
Pyruvate metabolism (hsa00620 )
Reactome Pathway
Pyruvate metabolism (R-HSA-70268 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-lactic acid DMO1Z5Q Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
L-lactic acid Discovery agent [N.A.] Investigative Km = 10.73 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.23E-03 3.32E-02 9.46E-02
Alopecia ED70 Skin from scalp 7.14E-01 -1.23E-01 -2.39E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.27E-04 -9.02E-02 -3.93E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.06E-01 -1.58E-02 -1.04E-01
Aortic stenosis BB70 Calcified aortic valve 7.53E-01 5.07E-02 1.35E-01
Apnea 7A40 Hyperplastic tonsil 8.28E-01 5.68E-02 2.28E-01
Arthropathy FA00-FA5Z Peripheral blood 5.31E-01 -1.58E-01 -6.87E-01
Asthma CA23 Nasal and bronchial airway 3.22E-02 1.22E-01 1.29E-01
Atopic dermatitis EA80 Skin 4.62E-01 -1.85E-01 -5.70E-01
Autism 6A02 Whole blood 3.35E-01 -1.54E-01 -5.26E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.86E-01 -2.28E-01 -1.52E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.95E-01 -3.70E-02 -2.47E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.98E-01 -1.24E-02 -3.72E-02
Batten disease 5C56.1 Whole blood 7.81E-01 4.89E-02 1.42E-01
Behcet's disease 4A62 Peripheral blood 4.79E-01 1.40E-01 2.75E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.05E-01 -4.52E-03 -1.80E-02
Bladder cancer 2C94 Bladder tissue 5.97E-03 9.89E-01 1.95E+00
Breast cancer 2C60-2C6Z Breast tissue 7.83E-01 -3.11E-02 -7.20E-02
Cardioembolic stroke 8B11.20 Whole blood 2.91E-01 -3.04E-02 -9.42E-02
Cervical cancer 2C77 Cervical tissue 1.83E-02 2.22E-01 7.91E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.41E-01 -1.06E-01 -5.03E-01
Chronic hepatitis C 1E51.1 Whole blood 3.72E-01 1.23E-01 4.11E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.09E-01 -4.59E-02 -1.43E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.17E-01 1.58E-01 2.28E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.17E-01 -4.67E-02 -1.42E-01
Colon cancer 2B90 Colon tissue 5.14E-06 1.42E-01 3.75E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.00E-01 -3.46E-01 -6.75E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.26E-01 4.56E-01 7.86E-01
Endometriosis GA10 Endometrium tissue 4.11E-02 3.40E-01 9.42E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.58E-01 7.90E-02 3.02E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.75E-02 -1.49E-01 -5.71E-01
Gastric cancer 2B72 Gastric tissue 2.54E-01 -2.86E-01 -1.39E+00
Glioblastopma 2A00.00 Nervous tissue 1.40E-01 -3.50E-02 -1.01E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.19E-01 -4.44E-01 -2.69E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.96E-02 -3.74E-01 -6.64E-01
Head and neck cancer 2D42 Head and neck tissue 1.07E-05 2.88E-01 6.76E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.47E-01 -1.74E-01 -8.85E-01
Huntington's disease 8A01.10 Whole blood 5.00E-01 -9.91E-02 -3.51E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.67E-01 -1.39E-01 -3.21E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.86E-02 2.30E-01 7.50E-01
Influenza 1E30 Whole blood 4.74E-01 3.37E-02 4.94E-01
Interstitial cystitis GC00.3 Bladder tissue 3.19E-01 2.01E-01 9.33E-01
Intracranial aneurysm 8B01.0 Intracranial artery 8.84E-01 -4.04E-02 -1.17E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.73E-02 9.39E-02 1.38E-01
Ischemic stroke 8B11 Peripheral blood 7.57E-01 7.73E-03 2.84E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 3.24E-01 3.99E-02 6.27E-02
Lateral sclerosis 8B60.4 Skin 6.30E-02 2.52E-01 1.20E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 4.99E-01 -9.04E-02 -4.68E-01
Liver cancer 2C12.0 Liver tissue 9.24E-01 -1.63E-01 -4.49E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.85E-02 -2.63E-01 -5.43E-01
Lung cancer 2C25 Lung tissue 5.58E-23 3.31E-01 8.81E-01
Lupus erythematosus 4A40 Whole blood 1.63E-01 -9.14E-02 -2.24E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.18E-01 -1.15E-02 -4.71E-02
Major depressive disorder 6A70-6A7Z Whole blood 1.19E-02 1.22E-01 4.02E-01
Melanoma 2C30 Skin 7.39E-01 1.53E-01 1.96E-01
Multiple myeloma 2A83.1 Peripheral blood 8.01E-01 -7.26E-02 -1.64E-01
Multiple myeloma 2A83.1 Bone marrow 1.08E-02 -3.77E-01 -1.40E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.45E-01 -2.35E-02 -3.19E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.01E-01 8.69E-02 1.52E-01
Myelofibrosis 2A20.2 Whole blood 8.83E-01 8.38E-02 5.48E-01
Myocardial infarction BA41-BA50 Peripheral blood 6.39E-01 3.79E-02 6.97E-02
Myopathy 8C70.6 Muscle tissue 1.20E-01 -4.20E-01 -9.40E-01
Neonatal sepsis KA60 Whole blood 1.25E-09 2.52E-01 9.24E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.64E-01 -2.82E-01 -7.00E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.74E-01 -1.86E-01 -3.45E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.98E-01 2.31E-03 6.78E-03
Olive pollen allergy CA08.00 Peripheral blood 3.60E-01 6.19E-02 2.79E-01
Oral cancer 2B6E Oral tissue 3.28E-01 2.49E-02 8.80E-02
Osteoarthritis FA00-FA0Z Synovial tissue 5.65E-01 1.29E-01 1.74E-01
Osteoporosis FB83.1 Bone marrow 1.36E-01 5.43E-02 6.70E-01
Ovarian cancer 2C73 Ovarian tissue 6.64E-02 3.67E-01 8.66E-01
Pancreatic cancer 2C10 Pancreas 9.07E-02 -1.19E-01 -3.31E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.41E-01 -9.68E-03 -3.82E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.43E-01 9.47E-03 2.77E-02
Pituitary cancer 2D12 Pituitary tissue 2.17E-05 5.50E-01 2.46E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.04E-02 2.89E-01 1.71E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.62E-02 2.92E-01 7.48E-01
Polycythemia vera 2A20.4 Whole blood 6.33E-01 -9.67E-03 -6.16E-02
Pompe disease 5C51.3 Biceps muscle 4.29E-01 -1.01E-01 -1.49E-01
Preterm birth KA21.4Z Myometrium 2.82E-01 0.00E+00 0.00E+00
Prostate cancer 2C82 Prostate 7.61E-02 -7.41E-02 -1.71E-01
Psoriasis EA90 Skin 6.96E-01 -1.37E-02 -3.37E-02
Rectal cancer 2B92 Rectal colon tissue 1.88E-01 2.32E-01 5.82E-01
Renal cancer 2C90-2C91 Kidney 3.17E-01 5.55E-02 1.35E-01
Retinoblastoma 2D02.2 Uvea 3.83E-02 5.30E-01 2.06E+00
Rheumatoid arthritis FA20 Synovial tissue 8.24E-01 3.12E-01 4.52E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.46E-01 8.88E-02 1.80E-01
Schizophrenia 6A20 Prefrontal cortex 4.99E-01 -2.64E-02 -8.44E-02
Schizophrenia 6A20 Superior temporal cortex 5.38E-01 3.39E-03 1.86E-02
Scleroderma 4A42.Z Whole blood 4.93E-02 1.58E-01 6.53E-01
Seizure 8A60-8A6Z Whole blood 2.72E-01 -6.33E-02 -2.21E-01
Sensitive skin EK0Z Skin 7.79E-02 -1.21E-01 -4.65E-01
Sepsis with septic shock 1G41 Whole blood 2.47E-23 1.97E-01 8.15E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.50E-01 1.95E-01 5.73E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.94E-01 2.23E-02 8.84E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 3.03E-01 2.44E-01 9.87E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.18E-01 3.42E-02 8.78E-02
Skin cancer 2C30-2C3Z Skin 1.23E-12 2.41E-01 5.48E-01
Thrombocythemia 3B63 Whole blood 3.06E-01 1.73E-03 1.09E-02
Thrombocytopenia 3B64 Whole blood 3.86E-01 -6.47E-02 -1.18E-01
Thyroid cancer 2D10 Thyroid 4.82E-01 -5.22E-03 -1.28E-02
Tibial muscular dystrophy 8C75 Muscle tissue 8.12E-03 -2.56E-01 -5.56E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.70E-01 -2.55E-02 -5.50E-02
Type 2 diabetes 5A11 Liver tissue 8.36E-01 3.56E-02 2.37E-01
Ureter cancer 2C92 Urothelium 1.68E-01 1.26E-01 5.24E-01
Uterine cancer 2C78 Endometrium tissue 5.18E-04 7.80E-02 1.94E-01
Vitiligo ED63.0 Skin 3.73E-02 5.40E-02 2.81E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Kinetic characterization of lactate dehydrogenase in normal and malignant human breast tissues. Cancer Cell Int. 2015 Feb 15;15:19.