Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DEQGIMN)
DME Name | Nitroreductase (NTR) | ||||
---|---|---|---|---|---|
Synonyms | FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; ntr1 | ||||
Gene Name | ntr1 | ||||
UniProt ID | |||||
INTEDE ID | |||||
EC Number | EC: 1.5.1.39 | ||||
Lineage | Species: Entamoeba histolytica | ||||
Tissue Distribution | Primarily distributed in human vagina. | ||||
Sequence |
MNMDLFYDRRSVRSYTGEKISEEDIDKIVRAGFYAPTAVNKQETEFIIIREKSLLENITK
IHPYSSMLKSSSHAIVVCANLKKAYTPEYWVCDASAATENILLAAHMLGYGAVWLGVYPE KDRMESIKKLLQLPEQVEILSIVSIGVSKVQPVNRPERFDATRLHNDKW |
||||
Function | This enzyme uses NADH as source of reducing equivalents to reduce of a variety of nitroaromatic compounds. | ||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||