Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEQPEMB)

• DME Name: Glutathione S-transferase zeta-1 (GSTZ1)
• Synonyms: Glutathione S-transferase zeta 1; Maleylacetoacetate isomerase; GSTZ1; GSTZ1-1; MAAI
• Gene Name: GSTZ1
• UniProt ID: MAAI_HUMAN
• INTEDE ID: DME0633
• Gene ID: 2954
• EC Number:
  EC: 2.5.1.18
  Transferase
  Alkyl/aryl transferase
  Alkyl/aryl transferase
  EC: 2.5.1.18
• Lineage:
  Species: Homo sapiens
  Kingdom: Metazoa
  Phylum: Chordata
  Class: Mammalia
  Order: Primates
  Family: Hominidae
  Genus: Homo
  Species: Homo sapiens
• Sequence:
  MQAGKPILYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVP
  TLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLK
  QVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDL
  TPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
• Function: This enzyme shows minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity, and it can catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid.
• KEGG Pathway:
  Metabolic pathways (hsa01100)
  Tyrosine metabolism (hsa00350)
• Reactome Pathway:
  Regulation of pyruvate dehydrogenase (PDH) complex (R-HSA-204174)
  Tyrosine catabolism (R-HSA-8963684)
  Glutathione conjugation (R-HSA-156590)

Molecular Interaction Atlas (MIA) of This DME

1 Clinical Trial Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CPC-211	DM2EO5M	N. A.	N. A.	Phase 3	[1]

Molecular Expression Atlas (MEA) of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	2.63E-13	3.57E-01	1.08E+00
Alzheimer's disease	8A20	Entorhinal cortex	4.24E-02	-6.33E-02	-2.31E-01
Asthma	CA23	Nasal and bronchial airway	7.04E-08	7.37E-01	9.50E-01
Behcet's disease	4A62	Peripheral blood	6.93E-01	-1.15E-02	-5.49E-02
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	7.48E-01	-8.52E-02	-3.65E-01
Bladder cancer	2C94	Bladder tissue	8.57E-03	-3.86E-01	-1.73E+00
Breast cancer	2C60-2C6Z	Breast tissue	2.17E-01	-3.79E-02	-6.90E-02
Colon cancer	2B90	Colon tissue	4.77E-81	-9.11E-01	-2.63E+00
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	2.84E-01	-1.45E-01	-3.21E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	8.31E-01	7.11E-02	3.08E-01
Gastric cancer	2B72	Gastric tissue	6.19E-01	-2.70E-02	-3.66E-02
Glioblastopma	2A00.00	Nervous tissue	1.91E-03	8.45E-02	2.24E-01
Head and neck cancer	2D42	Head and neck tissue	1.58E-18	-4.22E-01	-1.27E+00
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	2.26E-01	1.71E-01	4.18E-01
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	4.36E-01	-1.72E-02	-5.20E-02
Interstitial cystitis	GC00.3	Bladder tissue	2.54E-05	-7.45E-01	-4.32E+00
Ischemic stroke	8B11	Peripheral blood	3.52E-01	-7.19E-02	-2.82E-01
Liver cancer	2C12.0	Liver tissue	5.72E-20	-2.60E+00	-2.72E+00
Liver failure	DB99.7-DB99.8	Liver tissue	1.21E-02	-1.04E+00	-2.09E+00
Lung cancer	2C25	Lung tissue	2.66E-38	3.60E-01	1.23E+00
Lupus erythematosus	4A40	Whole blood	2.53E-02	2.88E-01	4.36E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	7.03E-01	1.61E-02	6.67E-02
Multiple myeloma	2A83.1	Bone marrow	2.47E-03	1.96E-01	1.07E+00
Multiple myeloma	2A83.1	Peripheral blood	5.38E-01	-1.87E-01	-2.57E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	5.89E-01	-1.10E-01	-3.64E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	3.30E-02	-2.20E-02	-5.30E-02
Myocardial infarction	BA41-BA50	Peripheral blood	1.66E-01	-8.46E-02	-1.58E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	3.06E-01	-1.59E-02	-6.44E-02
Non-alcoholic fatty liver disease	DB92	Liver tissue	1.98E-01	5.46E-01	9.63E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	2.64E-01	-1.98E-02	-7.16E-02
Olive pollen allergy	CA08.00	Peripheral blood	2.11E-01	5.60E-01	1.07E+00
Oral cancer	2B6E	Oral tissue	1.44E-04	-3.44E-01	-9.87E-01
Ovarian cancer	2C73	Ovarian tissue	1.10E-03	6.79E-01	1.56E+00
Pancreatic cancer	2C10	Pancreas	7.36E-01	-9.75E-02	-3.41E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	6.08E-04	-4.40E-01	-1.34E+00
Pituitary cancer	2D12	Pituitary tissue	6.78E-03	6.24E-01	1.41E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	1.39E-01	1.08E-01	5.89E-01
Pompe disease	5C51.3	Biceps muscle	8.45E-06	6.00E-01	5.17E+00
Prostate cancer	2C82	Prostate	2.03E-03	7.14E-01	8.23E-01
Psoriasis	EA90	Skin	1.23E-05	2.20E-01	6.22E-01
Rectal cancer	2B92	Rectal colon tissue	2.11E-21	-1.03E+00	-1.17E+01
Renal cancer	2C90-2C91	Kidney	3.04E-04	-4.10E-01	-1.52E+00
Retinoblastoma	2D02.2	Uvea	3.45E-06	9.81E-01	5.49E+00
Schizophrenia	6A20	Prefrontal cortex	8.43E-01	3.02E-02	1.11E-01
Schizophrenia	6A20	Superior temporal cortex	3.03E-02	-1.04E-01	-5.94E-01
Scleroderma	4A42.Z	Whole blood	2.73E-03	1.41E-01	1.15E+00
Seizure	8A60-8A6Z	Whole blood	8.60E-01	1.35E-01	4.30E-01
Sepsis with septic shock	1G41	Whole blood	7.94E-01	-8.28E-02	-2.14E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	6.52E-01	1.98E-01	9.63E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	5.53E-01	1.92E-01	6.56E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	2.83E-01	-4.18E-01	-6.99E-01
Skin cancer	2C30-2C3Z	Skin	8.57E-01	9.86E-02	2.10E-01
Thrombocythemia	3B63	Whole blood	4.35E-05	2.53E-01	2.10E+00
Thrombocytopenia	3B64	Whole blood	4.75E-01	4.02E-01	3.05E-01
Thyroid cancer	2D10	Thyroid	4.38E-11	-3.39E-01	-1.03E+00
Tibial muscular dystrophy	8C75	Muscle tissue	8.87E-06	-6.62E-01	-2.54E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	1.34E-01	2.87E-01	1.69E+00
Type 2 diabetes	5A11	Liver tissue	7.02E-01	-1.30E-01	-3.95E-01
Ureter cancer	2C92	Urothelium	3.17E-01	1.04E-01	3.17E-01
Uterine cancer	2C78	Endometrium tissue	5.57E-18	-9.86E-01	-1.41E+00
Vitiligo	ED63.0	Skin	7.94E-01	-1.01E-02	-2.69E-02

References

• [1] Personalized dosing of dichloroacetate using GSTZ1 clinical genotyping assay. Genet Test Mol Biomarkers. 2018 Apr;22(4):266-269.