General Information of Drug-Metabolizing Enzyme (DME) (ID: DEQYXD4)

DME Name Phosphorylcholine transferase A (PCYT1A)
Synonyms CTP:phosphocholine cytidylyltransferase A; Choline-phosphate cytidylyltransferase A; CCT-alpha; CCT A; CT A; CTPCT; PCYT1; PCYT1A
Gene Name PCYT1A
UniProt ID
PCY1A_HUMAN
INTEDE ID
DME0151
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5130
EC Number EC: 2.7.7.15
Transferase
Kinase
Nucleotidyltransferase
EC: 2.7.7.15
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYV
RVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHN
FKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDD
VYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKY
HLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEEKSREFIGSFLEMFGPEGALK
HMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPANLSRHKAAAYD
ISEDEED
Function This enzyme controls phosphatidylcholine synthesis.
KEGG Pathway
Choline metabolism in cancer (hsa05231 )
Glycerophospholipid metabolism (hsa00564 )
Metabolic pathways (hsa01100 )
Phosphonate and phosphinate metabolism (hsa00440 )
Reactome Pathway
Synthesis of PC (R-HSA-1483191 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Lamivudine DMI347A Chronic HBV infection 1E51.0Z Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.92E-03 -1.14E-01 -2.21E-01
Alopecia ED70 Skin from scalp 2.89E-01 4.27E-02 2.19E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.88E-01 1.06E-02 4.60E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 3.90E-01 5.51E-02 1.36E-01
Aortic stenosis BB70 Calcified aortic valve 6.52E-01 -4.49E-02 -1.32E-01
Apnea 7A40 Hyperplastic tonsil 5.16E-02 -7.32E-01 -1.74E+00
Arthropathy FA00-FA5Z Peripheral blood 4.18E-01 1.11E-01 6.40E-01
Asthma CA23 Nasal and bronchial airway 9.34E-01 4.60E-02 7.93E-02
Atopic dermatitis EA80 Skin 3.57E-08 -2.69E-01 -1.72E+00
Autism 6A02 Whole blood 3.83E-01 -1.16E-01 -3.81E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.30E-02 4.76E-01 2.39E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.99E-01 1.23E-02 3.47E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.54E-05 -1.53E-01 -5.83E-01
Batten disease 5C56.1 Whole blood 5.65E-02 1.69E-01 9.24E-01
Behcet's disease 4A62 Peripheral blood 7.16E-02 -1.26E-01 -8.01E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.55E-03 -7.04E-02 -4.59E-01
Bladder cancer 2C94 Bladder tissue 2.41E-02 2.73E-01 8.24E-01
Breast cancer 2C60-2C6Z Breast tissue 3.93E-27 -3.48E-01 -9.34E-01
Cardioembolic stroke 8B11.20 Whole blood 4.84E-05 2.82E-01 1.06E+00
Cervical cancer 2C77 Cervical tissue 3.86E-01 -2.05E-01 -6.76E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.63E-01 1.03E-01 1.76E-01
Chronic hepatitis C 1E51.1 Whole blood 5.93E-01 3.11E-02 1.16E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.96E-01 9.68E-02 3.30E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.51E-01 -6.02E-02 -1.90E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.49E-02 1.77E-01 1.21E+00
Colon cancer 2B90 Colon tissue 1.78E-19 -3.57E-01 -1.05E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.36E-01 -6.43E-02 -1.28E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.85E-01 -3.70E-01 -8.05E-01
Endometriosis GA10 Endometrium tissue 1.39E-01 2.76E-01 6.56E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.96E-01 1.11E-01 4.40E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.83E-03 2.33E-01 8.93E-01
Gastric cancer 2B72 Gastric tissue 9.54E-02 3.04E-01 1.90E+00
Glioblastopma 2A00.00 Nervous tissue 5.91E-02 -5.63E-02 -1.10E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.36E-01 5.32E-02 2.01E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.27E-01 4.03E-01 6.28E-01
Head and neck cancer 2D42 Head and neck tissue 2.58E-22 4.97E-01 1.86E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.79E-01 3.98E-02 2.58E-01
Huntington's disease 8A01.10 Whole blood 5.59E-01 7.36E-02 1.80E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.04E-01 -2.93E-02 -1.84E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.68E-01 -3.78E-02 -2.77E-01
Influenza 1E30 Whole blood 7.98E-02 -6.17E-01 -1.95E+00
Interstitial cystitis GC00.3 Bladder tissue 1.59E-01 1.98E-01 9.98E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.26E-01 2.40E-03 9.55E-03
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.72E-01 -8.31E-02 -2.61E-01
Ischemic stroke 8B11 Peripheral blood 1.93E-01 -6.12E-02 -3.36E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.59E-01 -1.01E-01 -3.84E-01
Lateral sclerosis 8B60.4 Skin 8.88E-01 5.59E-02 1.47E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 1.18E-01 -3.63E-01 -5.86E-01
Liver cancer 2C12.0 Liver tissue 7.62E-01 -8.56E-02 -3.08E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.98E-03 4.21E-01 1.69E+00
Lung cancer 2C25 Lung tissue 3.91E-04 -1.79E-02 -6.67E-02
Lupus erythematosus 4A40 Whole blood 1.00E-07 2.54E-01 6.00E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.20E-01 -3.72E-03 -2.48E-02
Major depressive disorder 6A70-6A7Z Whole blood 4.64E-01 1.76E-02 6.49E-02
Melanoma 2C30 Skin 1.10E-01 -2.05E-01 -4.14E-01
Multiple myeloma 2A83.1 Peripheral blood 7.69E-01 1.65E-02 7.23E-02
Multiple myeloma 2A83.1 Bone marrow 1.55E-02 -2.22E-01 -8.13E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.39E-01 2.95E-01 1.08E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.33E-02 1.47E-01 5.09E-01
Myelofibrosis 2A20.2 Whole blood 2.98E-02 -2.29E-01 -1.58E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.48E-01 3.32E-02 4.32E-02
Myopathy 8C70.6 Muscle tissue 3.82E-01 2.52E-02 4.13E-02
Neonatal sepsis KA60 Whole blood 3.52E-28 8.62E-01 2.25E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.78E-05 -6.51E-01 -2.32E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.85E-01 5.77E-02 3.43E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.67E-01 -8.31E-02 -3.26E-01
Olive pollen allergy CA08.00 Peripheral blood 5.24E-01 -1.04E-01 -3.76E-01
Oral cancer 2B6E Oral tissue 1.90E-05 5.14E-01 1.11E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.61E-01 2.06E-01 4.29E-01
Osteoporosis FB83.1 Bone marrow 5.25E-01 1.05E-01 3.93E-01
Ovarian cancer 2C73 Ovarian tissue 4.12E-02 3.02E-01 9.27E-01
Pancreatic cancer 2C10 Pancreas 3.10E-01 -4.61E-02 -1.22E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.63E-04 -3.58E-01 -2.86E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.41E-03 2.66E-01 1.10E+00
Pituitary cancer 2D12 Pituitary tissue 7.47E-01 3.36E-02 1.58E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.76E-01 9.70E-02 3.63E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.68E-01 2.17E-02 8.73E-02
Polycythemia vera 2A20.4 Whole blood 1.19E-01 -6.20E-02 -3.75E-01
Pompe disease 5C51.3 Biceps muscle 6.35E-01 1.74E-01 1.09E+00
Preterm birth KA21.4Z Myometrium 7.45E-02 3.42E-01 1.16E+00
Prostate cancer 2C82 Prostate 7.80E-03 4.49E-01 8.63E-01
Psoriasis EA90 Skin 5.20E-04 7.26E-02 2.77E-01
Rectal cancer 2B92 Rectal colon tissue 4.56E-03 -3.10E-01 -2.16E+00
Renal cancer 2C90-2C91 Kidney 1.83E-01 1.25E-01 5.52E-01
Retinoblastoma 2D02.2 Uvea 8.30E-01 -6.62E-02 -3.39E-01
Rheumatoid arthritis FA20 Synovial tissue 3.02E-04 1.12E+00 3.21E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.40E-02 1.59E-02 1.27E-01
Schizophrenia 6A20 Prefrontal cortex 5.53E-01 1.51E-01 2.83E-01
Schizophrenia 6A20 Superior temporal cortex 7.55E-01 -1.19E-02 -7.88E-02
Scleroderma 4A42.Z Whole blood 3.56E-06 4.12E-01 2.99E+00
Seizure 8A60-8A6Z Whole blood 2.32E-01 -9.66E-02 -2.72E-01
Sensitive skin EK0Z Skin 6.25E-01 -2.21E-03 -2.30E-02
Sepsis with septic shock 1G41 Whole blood 1.08E-67 9.33E-01 2.22E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.95E-01 1.98E-01 7.31E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.77E-03 -1.54E-01 -1.02E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 6.62E-01 -2.14E-01 -4.11E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.98E-01 8.69E-02 6.32E-01
Skin cancer 2C30-2C3Z Skin 1.12E-10 -4.17E-01 -1.29E+00
Thrombocythemia 3B63 Whole blood 5.06E-05 -1.77E-01 -1.15E+00
Thrombocytopenia 3B64 Whole blood 2.88E-01 -4.99E-01 -8.93E-01
Thyroid cancer 2D10 Thyroid 9.20E-03 -8.46E-02 -3.69E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.30E-01 -1.87E-01 -4.68E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.91E-01 -4.26E-02 -3.15E-01
Type 2 diabetes 5A11 Liver tissue 3.40E-01 1.73E-01 8.54E-01
Ureter cancer 2C92 Urothelium 1.57E-01 -1.06E-01 -4.29E-01
Uterine cancer 2C78 Endometrium tissue 5.53E-06 2.48E-01 5.42E-01
Vitiligo ED63.0 Skin 4.29E-02 2.38E-01 1.01E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Model for intracellular Lamivudine metabolism in peripheral blood mononuclear cells ex vivo and in human immunodeficiency virus type 1-infected adolescents. Antimicrob Agents Chemother. 2006 Aug;50(8):2686-94.