Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DER0EN5)

DME Name Phosphoglucomutase 3 (PGM3)
Synonyms Acetylglucosamine phosphomutase; N-acetylglucosamine-phosphate mutase; Phosphoacetylglucosamine mutase; Phosphoglucomutase-3; AGM1; PAGM; PGM 3; PGM3
Gene Name PGM3
UniProt ID
AGM1_HUMAN
INTEDE ID
DME0536
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5238
EC Number EC: 5.4.2.3
Isomerase
Mutase
Phosphomutase
EC: 5.4.2.3
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDLGAITKYSALHAKPNGLILQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVM
VTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLANAEEQDMQRVLIDISEKEAVNLQQD
AFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMVYCRNTGGRYGKATI
EGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKLREMEHYFSQGLSVQLFNDG
SKGKLNHLCGADFVKSHQKPPQGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDK
IATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKA
QEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAI
SDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTDAERQAVTPPGLQEA
INDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQESADHLAHEVSLAVFQLAGGIGERPQP
GF
Function
This enzyme catalyzes the conversion of GlcNAc-6-P into GlcNAc-1-P during the synthesis of uridine diphosphate/UDP-GlcNAc, a sugar nucleotide critical to multiple glycosylation pathways including protein N- and O- glycosylation.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Synthesis of UDP-N-acetyl-glucosamine (R-HSA-446210 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
NA-alpha-D-glucosamine DMRKIYB N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.71E-02 -1.13E-01 -4.49E-01
Alopecia ED70 Skin from scalp 2.05E-04 1.03E-01 6.49E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.51E-02 6.48E-02 2.20E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.30E-01 1.09E-02 5.50E-02
Aortic stenosis BB70 Calcified aortic valve 6.02E-01 7.00E-01 4.16E-01
Apnea 7A40 Hyperplastic tonsil 9.27E-01 -4.51E-02 -9.09E-02
Arthropathy FA00-FA5Z Peripheral blood 1.09E-01 -2.46E-01 -1.01E+00
Asthma CA23 Nasal and bronchial airway 4.82E-03 2.45E-01 4.60E-01
Atopic dermatitis EA80 Skin 6.90E-09 -3.21E-01 -1.58E+00
Autism 6A02 Whole blood 9.15E-01 -1.16E-02 -3.70E-02
Autoimmune uveitis 9A96 Peripheral monocyte 6.30E-01 -2.17E-01 -7.73E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.84E-01 1.22E-01 1.56E+00
Bacterial infection of gingival 1C1H Gingival tissue 6.54E-07 3.00E-01 8.71E-01
Batten disease 5C56.1 Whole blood 6.84E-01 -1.27E-01 -5.36E-01
Behcet's disease 4A62 Peripheral blood 6.17E-01 -2.09E-02 -1.05E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.74E-01 5.96E-02 2.78E-01
Bladder cancer 2C94 Bladder tissue 9.62E-02 -1.74E-01 -7.91E-01
Breast cancer 2C60-2C6Z Breast tissue 2.36E-17 3.75E-01 6.89E-01
Cardioembolic stroke 8B11.20 Whole blood 8.15E-01 -7.39E-02 -2.63E-01
Cervical cancer 2C77 Cervical tissue 5.17E-02 1.83E-01 4.30E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.86E-01 -4.27E-02 -8.81E-02
Chronic hepatitis C 1E51.1 Whole blood 1.97E-01 -1.94E-01 -8.44E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.24E-01 5.86E-02 1.45E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.35E-01 1.83E-01 4.49E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.94E-01 2.83E-01 5.80E-01
Colon cancer 2B90 Colon tissue 6.70E-18 3.63E-01 8.04E-01
Coronary artery disease BA80-BA8Z Peripheral blood 5.11E-01 -2.44E-01 -2.90E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.68E-01 4.81E-02 8.37E-02
Endometriosis GA10 Endometrium tissue 9.72E-01 -2.92E-01 -4.93E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.31E-01 -3.14E-02 -1.46E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.04E-03 1.81E-01 9.66E-01
Gastric cancer 2B72 Gastric tissue 5.95E-01 1.86E-01 1.52E-01
Glioblastopma 2A00.00 Nervous tissue 1.40E-109 8.42E-01 1.84E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.35E-07 6.59E-01 1.28E+01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.20E-05 1.15E+00 2.09E+00
Head and neck cancer 2D42 Head and neck tissue 1.14E-04 2.23E-01 5.19E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.73E-01 -2.20E-02 -7.24E-02
Huntington's disease 8A01.10 Whole blood 9.76E-01 8.78E-03 7.71E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.96E-01 -4.13E-01 -9.18E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.19E-06 -2.49E-01 -3.91E+00
Influenza 1E30 Whole blood 7.11E-04 -1.88E+00 -7.64E+00
Interstitial cystitis GC00.3 Bladder tissue 1.88E-02 3.34E-01 1.57E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.35E-06 8.76E-01 3.02E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.33E-01 -1.34E-02 -7.58E-02
Ischemic stroke 8B11 Peripheral blood 4.46E-02 -2.19E-01 -7.51E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.81E-01 -1.23E-01 -2.83E-01
Lateral sclerosis 8B60.4 Skin 1.65E-01 -1.07E-01 -5.81E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.54E-01 -4.87E-02 -1.46E-01
Liver cancer 2C12.0 Liver tissue 2.31E-02 -3.31E-01 -4.31E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.47E-03 -6.48E-01 -1.90E+00
Lung cancer 2C25 Lung tissue 5.55E-05 2.39E-01 6.46E-01
Lupus erythematosus 4A40 Whole blood 8.48E-01 1.10E-01 1.57E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.88E-01 -5.86E-02 -2.80E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.97E-01 -2.02E-02 -5.01E-02
Melanoma 2C30 Skin 6.05E-01 -1.25E-01 -1.26E-01
Multiple myeloma 2A83.1 Peripheral blood 2.13E-01 1.02E-01 5.89E-01
Multiple myeloma 2A83.1 Bone marrow 8.99E-01 -1.44E-02 -4.37E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.74E-01 6.51E-02 2.09E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.18E-04 4.37E-01 1.18E+00
Myelofibrosis 2A20.2 Whole blood 4.40E-03 -1.57E-01 -1.03E+00
Myocardial infarction BA41-BA50 Peripheral blood 5.91E-03 -7.38E-01 -8.95E-01
Myopathy 8C70.6 Muscle tissue 2.49E-02 2.22E-01 4.84E-01
Neonatal sepsis KA60 Whole blood 2.63E-04 -2.36E-01 -7.27E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.26E-06 1.45E+00 3.18E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.03E-01 -4.57E-02 -9.17E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.15E-01 1.46E-01 3.92E-01
Olive pollen allergy CA08.00 Peripheral blood 3.54E-01 -4.34E-01 -9.33E-01
Oral cancer 2B6E Oral tissue 5.21E-06 6.87E-01 1.12E+00
Osteoarthritis FA00-FA0Z Synovial tissue 7.78E-02 3.62E-01 4.36E-01
Osteoporosis FB83.1 Bone marrow 8.72E-02 -1.85E-01 -9.68E-01
Ovarian cancer 2C73 Ovarian tissue 7.25E-02 2.99E-01 6.21E-01
Pancreatic cancer 2C10 Pancreas 2.14E-01 -3.64E-01 -6.38E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.05E-01 4.33E-02 9.76E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.90E-01 -3.25E-02 -1.44E-01
Pituitary cancer 2D12 Pituitary tissue 3.13E-04 -6.69E-01 -2.01E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.00E-08 -6.84E-01 -4.05E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.03E-01 -3.99E-02 -2.40E-01
Polycythemia vera 2A20.4 Whole blood 1.34E-03 -9.11E-02 -6.39E-01
Pompe disease 5C51.3 Biceps muscle 3.01E-01 9.85E-02 6.22E-01
Preterm birth KA21.4Z Myometrium 4.02E-01 -1.13E-01 -2.65E-01
Prostate cancer 2C82 Prostate 1.98E-01 6.48E-01 7.33E-01
Psoriasis EA90 Skin 1.11E-03 1.75E-01 4.54E-01
Rectal cancer 2B92 Rectal colon tissue 5.56E-01 -1.38E-01 -3.19E-01
Renal cancer 2C90-2C91 Kidney 2.72E-03 1.02E+00 1.51E+00
Retinoblastoma 2D02.2 Uvea 3.63E-04 -4.50E-01 -3.20E+00
Rheumatoid arthritis FA20 Synovial tissue 4.16E-02 8.76E-02 1.51E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.11E-02 1.28E-01 6.07E-01
Schizophrenia 6A20 Prefrontal cortex 1.40E-01 -2.71E-02 -9.12E-02
Schizophrenia 6A20 Superior temporal cortex 9.24E-01 -6.49E-03 -4.54E-02
Scleroderma 4A42.Z Whole blood 3.36E-01 -1.42E-01 -8.95E-01
Seizure 8A60-8A6Z Whole blood 7.38E-01 -5.59E-02 -1.68E-01
Sensitive skin EK0Z Skin 3.21E-01 -7.19E-02 -6.00E-01
Sepsis with septic shock 1G41 Whole blood 2.75E-17 -3.02E-01 -9.82E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.17E-01 -8.81E-02 -1.99E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.64E-03 -1.46E-01 -1.05E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.37E-01 -1.67E-01 -2.00E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.79E-01 5.81E-02 1.92E-01
Skin cancer 2C30-2C3Z Skin 4.01E-09 3.04E-01 7.35E-01
Thrombocythemia 3B63 Whole blood 1.52E-01 -4.04E-02 -2.80E-01
Thrombocytopenia 3B64 Whole blood 7.70E-01 1.17E-01 1.23E-01
Thyroid cancer 2D10 Thyroid 2.87E-01 1.40E-02 3.82E-02
Tibial muscular dystrophy 8C75 Muscle tissue 1.47E-03 4.25E-01 1.17E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.48E-02 3.81E-01 1.76E+00
Type 2 diabetes 5A11 Liver tissue 1.23E-01 2.89E-01 1.89E+00
Ureter cancer 2C92 Urothelium 2.06E-01 6.49E-02 5.12E-01
Uterine cancer 2C78 Endometrium tissue 6.03E-02 6.39E-02 9.13E-02
Vitiligo ED63.0 Skin 3.23E-01 -5.07E-02 -4.68E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Functional cloning and mutational analysis of the human cDNA for phosphoacetylglucosamine mutase: identification of the amino acid residues essential for the catalysis. Biochim Biophys Acta. 2000 Jul 24;1492(2-3):369-76.