Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DER5HFI)

DME Name Alanine aminotransferase 1 (GPT)
Synonyms Glutamate pyruvate transaminase 1; Glutamic--alanine transaminase 1; Glutamic--pyruvic transaminase 1; AAT1; ALT1; GPT; GPT 1; GPT1
Gene Name GPT
UniProt ID
ALAT1_HUMAN
INTEDE ID
DME0531
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2875
EC Number EC: 2.6.1.2
Transferase
Transaminase
Transaminase
EC: 2.6.1.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPF
TEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSL
GAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRT
GVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVI
NPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPY
AGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDL
VVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL
PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLL
LEKLSRFHAKFTLEYS
Function This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. It participates in cellular nitrogen metabolism.
KEGG Pathway
2-Oxocarboxylic acid metabolism (hsa01210 )
Alanine, aspartate and glutamate metabolism (hsa00250 )
Arginine biosynthesis (hsa00220 )
Biosynthesis of amino acids (hsa01230 )
Carbon metabolism (hsa01200 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Alanine metabolism (R-HSA-8964540 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Glyoxylate DMJ9XZO N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.96E-04 -8.14E-02 -3.29E-01
Alopecia ED70 Skin from scalp 7.43E-02 1.04E-01 3.13E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.41E-01 2.01E-02 1.34E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.50E-01 -8.04E-02 -4.52E-01
Aortic stenosis BB70 Calcified aortic valve 4.43E-01 3.50E-02 1.42E-01
Apnea 7A40 Hyperplastic tonsil 5.81E-02 -5.38E-01 -1.31E+00
Arthropathy FA00-FA5Z Peripheral blood 5.02E-01 5.57E-02 3.34E-01
Asthma CA23 Nasal and bronchial airway 5.00E-02 -7.76E-02 -2.65E-01
Atopic dermatitis EA80 Skin 8.25E-01 -1.25E-01 -5.69E-01
Autism 6A02 Whole blood 6.22E-01 -1.98E-02 -5.93E-02
Autoimmune uveitis 9A96 Peripheral monocyte 3.63E-01 -1.45E-02 -8.52E-02
Autosomal dominant monocytopenia 4B04 Whole blood 9.22E-01 -9.46E-03 -9.66E-02
Bacterial infection of gingival 1C1H Gingival tissue 4.15E-01 5.21E-03 1.84E-02
Batten disease 5C56.1 Whole blood 6.54E-01 4.89E-02 8.46E-01
Behcet's disease 4A62 Peripheral blood 5.13E-02 9.33E-02 4.40E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.08E-01 -6.43E-02 -3.91E-01
Bladder cancer 2C94 Bladder tissue 8.26E-01 -1.07E-01 -4.19E-01
Breast cancer 2C60-2C6Z Breast tissue 1.12E-01 -4.59E-02 -1.01E-01
Cardioembolic stroke 8B11.20 Whole blood 8.12E-02 -7.33E-02 -6.13E-01
Cervical cancer 2C77 Cervical tissue 1.37E-02 -7.59E-02 -4.77E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.81E-01 5.95E-02 2.01E-01
Chronic hepatitis C 1E51.1 Whole blood 4.86E-01 8.12E-02 4.59E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.80E-01 -4.53E-03 -1.87E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.74E-03 -1.29E-01 -4.95E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.57E-01 -9.42E-02 -4.26E-01
Colon cancer 2B90 Colon tissue 3.76E-82 -8.71E-01 -2.71E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.82E-01 5.05E-02 1.95E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.71E-01 -9.56E-02 -4.27E-01
Endometriosis GA10 Endometrium tissue 9.20E-01 -7.15E-02 -2.50E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.02E-01 4.41E-03 2.14E-02
Familial hypercholesterolemia 5C80.00 Whole blood 2.92E-05 -5.03E-01 -1.76E+00
Gastric cancer 2B72 Gastric tissue 8.48E-01 -2.28E-01 -3.80E-01
Glioblastopma 2A00.00 Nervous tissue 1.89E-03 -6.43E-02 -2.09E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.88E-01 -9.28E-02 -2.37E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.43E-04 -9.03E-01 -2.55E+00
Head and neck cancer 2D42 Head and neck tissue 1.26E-05 -1.54E-01 -5.03E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.05E-01 -3.50E-03 -1.98E-02
Huntington's disease 8A01.10 Whole blood 6.68E-01 2.58E-02 1.43E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.54E-01 2.07E-02 1.92E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.56E-01 7.57E-02 5.65E-01
Influenza 1E30 Whole blood 3.08E-02 3.78E-01 2.32E+00
Interstitial cystitis GC00.3 Bladder tissue 9.57E-01 -3.30E-02 -3.84E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.00E-01 -5.95E-04 -2.43E-03
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.45E-01 -1.53E-01 -3.55E-01
Ischemic stroke 8B11 Peripheral blood 2.33E-01 5.31E-02 3.22E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.24E-01 3.02E-03 9.90E-03
Lateral sclerosis 8B60.4 Skin 1.98E-02 9.98E-02 1.30E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 3.33E-01 -7.94E-02 -2.86E-01
Liver cancer 2C12.0 Liver tissue 8.23E-12 -1.13E+00 -1.76E+00
Liver failure DB99.7-DB99.8 Liver tissue 7.09E-02 -7.32E-01 -1.15E+00
Lung cancer 2C25 Lung tissue 1.55E-03 1.86E-02 6.36E-02
Lupus erythematosus 4A40 Whole blood 3.13E-01 -1.49E-01 -2.55E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.43E-01 -2.10E-02 -1.31E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.12E-01 -6.46E-02 -3.17E-01
Melanoma 2C30 Skin 6.14E-06 -1.21E+00 -1.34E+00
Multiple myeloma 2A83.1 Peripheral blood 3.34E-01 -5.18E-02 -2.65E-01
Multiple myeloma 2A83.1 Bone marrow 7.32E-03 3.09E-01 1.40E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.34E-01 -5.80E-02 -3.71E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.09E-01 -1.68E-02 -9.29E-02
Myelofibrosis 2A20.2 Whole blood 9.18E-01 -6.71E-03 -5.12E-02
Myocardial infarction BA41-BA50 Peripheral blood 1.82E-01 1.74E-01 5.56E-01
Myopathy 8C70.6 Muscle tissue 2.22E-01 -8.50E-02 -4.47E-01
Neonatal sepsis KA60 Whole blood 1.45E-10 -4.37E-01 -1.20E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.74E-01 2.21E-02 8.11E-02
Non-alcoholic fatty liver disease DB92 Liver tissue 8.58E-01 1.79E-01 3.85E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.39E-01 9.68E-02 9.40E-01
Olive pollen allergy CA08.00 Peripheral blood 3.47E-01 2.46E-01 8.04E-01
Oral cancer 2B6E Oral tissue 3.53E-05 -4.58E-01 -9.84E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.45E-01 -3.27E-02 -1.28E-01
Osteoporosis FB83.1 Bone marrow 1.82E-02 3.76E-01 2.10E+00
Ovarian cancer 2C73 Ovarian tissue 2.23E-01 2.17E-01 6.26E-01
Pancreatic cancer 2C10 Pancreas 5.63E-02 -4.08E-01 -7.87E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.81E-02 -1.08E-01 -4.86E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.91E-02 -2.24E-03 -1.34E-02
Pituitary cancer 2D12 Pituitary tissue 1.74E-01 -6.34E-03 -2.28E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.40E-01 9.78E-02 3.03E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.52E-01 5.57E-02 2.68E-01
Polycythemia vera 2A20.4 Whole blood 2.73E-04 -1.07E-01 -7.37E-01
Pompe disease 5C51.3 Biceps muscle 1.28E-03 -5.43E-01 -2.49E+00
Preterm birth KA21.4Z Myometrium 5.67E-01 2.12E-02 5.56E-01
Prostate cancer 2C82 Prostate 1.79E-02 2.21E-01 5.14E-01
Psoriasis EA90 Skin 1.33E-06 -1.82E-01 -4.50E-01
Rectal cancer 2B92 Rectal colon tissue 1.56E-03 -5.03E-01 -1.91E+00
Renal cancer 2C90-2C91 Kidney 5.84E-01 -2.60E-01 -5.36E-01
Retinoblastoma 2D02.2 Uvea 5.75E-01 -1.93E-02 -1.26E-01
Rheumatoid arthritis FA20 Synovial tissue 3.23E-02 -3.51E-01 -1.09E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.80E-01 -2.64E-03 -1.80E-02
Schizophrenia 6A20 Prefrontal cortex 9.80E-01 3.58E-03 1.85E-02
Schizophrenia 6A20 Superior temporal cortex 5.32E-01 -7.61E-02 -6.87E-01
Scleroderma 4A42.Z Whole blood 1.39E-05 3.07E-01 2.71E+00
Seizure 8A60-8A6Z Whole blood 6.77E-01 5.85E-02 2.74E-01
Sensitive skin EK0Z Skin 6.34E-01 -3.73E-02 -1.33E-01
Sepsis with septic shock 1G41 Whole blood 1.23E-08 -2.41E-01 -7.76E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.07E-01 -7.51E-02 -6.49E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.11E-01 1.57E-01 1.24E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.02E-01 1.45E-01 4.97E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.97E-05 -7.10E-01 -6.88E+00
Skin cancer 2C30-2C3Z Skin 4.59E-57 -7.60E-01 -1.57E+00
Thrombocythemia 3B63 Whole blood 2.06E-02 -1.35E-01 -9.01E-01
Thrombocytopenia 3B64 Whole blood 2.68E-01 2.51E-01 6.00E-01
Thyroid cancer 2D10 Thyroid 1.12E-06 1.57E-01 5.29E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.14E-04 -5.86E-01 -1.64E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.88E-01 4.65E-02 1.01E+00
Type 2 diabetes 5A11 Liver tissue 6.73E-02 -3.24E-01 -8.69E-01
Ureter cancer 2C92 Urothelium 9.51E-01 -2.86E-02 -1.07E-01
Uterine cancer 2C78 Endometrium tissue 2.78E-01 -3.57E-02 -1.17E-01
Vitiligo ED63.0 Skin 8.78E-01 -3.04E-03 -1.14E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Recombinant production of eight human cytosolic aminotransferases and assessment of their potential involvement in glyoxylate metabolism. Biochem J. 2009 Aug 13;422(2):265-72.