Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DER6BCE)

DME Name Acid phosphatase-like protein 1 (ACP6)
Synonyms Lysophosphatidic acid phosphatase type 6; Acid phosphatase 6 lysophosphatidic; ACP6; ACPL1; LPAP; PACPL1; UNQ205/PRO231
Gene Name ACP6
UniProt ID
PPA6_HUMAN
INTEDE ID
DME0231
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
51205
EC Number EC: 3.1.3.2
Hydrolases
Ester bond hydrolase
Phosphoric monoester hydrolase
EC: 3.1.3.2
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MITGVFSMRLWTPVGVLTSLAYCLHQRRVALAELQEADGQCPVDRSLLKLKMVQVVFRHG
ARSPLKPLPLEEQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGMF
AGQLTKVGMQQMFALGERLRKNYVEDIPFLSPTFNPQEVFIRSTNIFRNLESTRCLLAGL
FQCQKEGPIIIHTDEADSEVLYPNYQSCWSLRQRTRGRRQTASLQPGISEDLKKVKDRMG
IDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMA
VGPFLHILESNLLKAMDSATAPDKIRKLYLYAAHDVTFIPLLMTLGIFDHKWPPFAVDLT
MELYQHLESKEWFVQLYYHGKEQVPRGCPDGLCPLDMFLNAMSVYTLSPEKYHALCSQTQ
VMEVGNEE
Function
This enzyme hydrolyzes lysophosphatidic acid (LPA) containing a medium length fatty acid chain to the corresponding monoacylglycerol. It has highest activity with lysophosphatidic acid containing myristate (C14:0), monounsaturated oleate (C18:1) or palmitate (C16:0), and lower activity with C18:0 and C6:0 lysophosphatidic acid.
Reactome Pathway
Synthesis of PA (R-HSA-1483166 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Riboflavin DM8YMWE Acne vulgaris ED80 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.45E-34 -6.99E-01 -1.57E+00
Alopecia ED70 Skin from scalp 2.12E-07 5.69E-01 1.22E+00
Alzheimer's disease 8A20 Entorhinal cortex 2.63E-05 1.56E-01 4.84E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.96E-01 1.01E-02 4.78E-02
Aortic stenosis BB70 Calcified aortic valve 2.12E-02 -1.81E-01 -6.24E-01
Apnea 7A40 Hyperplastic tonsil 4.46E-01 -5.77E-03 -3.45E-02
Arthropathy FA00-FA5Z Peripheral blood 1.23E-02 -2.74E-01 -1.14E+00
Asthma CA23 Nasal and bronchial airway 1.03E-04 2.97E-01 4.54E-01
Atopic dermatitis EA80 Skin 1.88E-02 -2.74E-01 -6.73E-01
Autism 6A02 Whole blood 8.79E-01 4.09E-02 1.49E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.32E-01 -1.38E-01 -7.65E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.40E-01 6.85E-01 6.33E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.33E-02 -9.01E-02 -4.33E-01
Batten disease 5C56.1 Whole blood 1.24E-01 3.42E-01 2.16E+00
Behcet's disease 4A62 Peripheral blood 8.85E-01 -2.29E-02 -1.63E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.35E-02 1.95E-01 5.33E-01
Bladder cancer 2C94 Bladder tissue 3.28E-01 -2.55E-03 -7.00E-03
Breast cancer 2C60-2C6Z Breast tissue 5.84E-16 2.27E-01 4.70E-01
Cardioembolic stroke 8B11.20 Whole blood 1.35E-04 4.44E-01 1.17E+00
Cervical cancer 2C77 Cervical tissue 8.31E-01 -5.26E-02 -2.09E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.66E-02 -2.26E-01 -9.83E-01
Chronic hepatitis C 1E51.1 Whole blood 1.86E-02 -2.42E-01 -1.33E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 7.72E-01 -1.47E-02 -4.99E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.17E-01 -3.42E-02 -1.36E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.50E-01 -1.17E-01 -7.87E-01
Colon cancer 2B90 Colon tissue 2.41E-67 5.87E-01 2.03E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.54E-02 1.78E-01 1.22E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.42E-01 1.08E-01 2.27E-01
Endometriosis GA10 Endometrium tissue 3.30E-04 -4.69E-01 -6.98E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.13E-01 1.76E-01 7.22E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.88E-03 -2.57E-01 -9.12E-01
Gastric cancer 2B72 Gastric tissue 1.17E-01 -2.33E-01 -2.50E+00
Glioblastopma 2A00.00 Nervous tissue 1.20E-41 3.60E-01 8.33E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 2.94E-04 3.73E-01 6.27E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.28E-02 4.97E-01 1.05E+00
Head and neck cancer 2D42 Head and neck tissue 1.35E-36 -9.35E-01 -2.34E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.73E-01 1.15E-01 6.18E-01
Huntington's disease 8A01.10 Whole blood 5.70E-01 1.82E-02 1.11E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.67E-01 9.49E-02 5.95E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.08E-03 -1.69E-01 -1.29E+00
Influenza 1E30 Whole blood 2.17E-02 2.43E-01 4.18E+00
Interstitial cystitis GC00.3 Bladder tissue 3.49E-02 -7.63E-01 -2.16E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.00E-03 -6.31E-01 -1.33E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.01E-01 8.62E-02 2.16E-01
Ischemic stroke 8B11 Peripheral blood 7.65E-01 -1.08E-02 -6.16E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.87E-02 -1.50E-01 -3.66E-01
Lateral sclerosis 8B60.4 Skin 7.59E-01 -4.62E-02 -2.58E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.93E-01 -1.32E-01 -4.63E-01
Liver cancer 2C12.0 Liver tissue 3.16E-08 2.67E-01 9.74E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.42E-02 -2.75E-01 -1.76E+00
Lung cancer 2C25 Lung tissue 1.16E-52 4.51E-01 1.57E+00
Lupus erythematosus 4A40 Whole blood 1.62E-01 1.12E-01 3.51E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.94E-02 1.77E-01 4.77E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.95E-01 5.05E-02 1.36E-01
Melanoma 2C30 Skin 1.19E-01 -8.44E-01 -7.23E-01
Multiple myeloma 2A83.1 Peripheral blood 7.95E-01 1.18E-01 3.53E-01
Multiple myeloma 2A83.1 Bone marrow 7.52E-01 -1.51E-02 -3.96E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.00E-01 -3.40E-01 -1.03E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.27E-03 2.00E-01 4.61E-01
Myelofibrosis 2A20.2 Whole blood 2.41E-04 2.91E-01 2.00E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.83E-03 -2.09E-01 -2.98E-01
Myopathy 8C70.6 Muscle tissue 9.57E-01 -5.27E-02 -2.41E-01
Neonatal sepsis KA60 Whole blood 1.55E-03 1.41E-01 5.36E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.40E-03 -3.09E-01 -1.44E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.98E-02 1.50E-01 7.55E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.86E-01 -1.95E-02 -1.05E-01
Olive pollen allergy CA08.00 Peripheral blood 5.11E-01 2.04E-01 4.95E-01
Oral cancer 2B6E Oral tissue 4.24E-07 -5.76E-01 -1.57E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.43E-01 -1.39E-01 -6.18E-01
Osteoporosis FB83.1 Bone marrow 8.60E-01 -4.37E-02 -2.35E-01
Ovarian cancer 2C73 Ovarian tissue 1.09E-03 6.03E-01 1.23E+00
Pancreatic cancer 2C10 Pancreas 2.71E-04 2.17E-01 6.04E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.94E-01 8.96E-02 3.85E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.19E-01 7.71E-02 4.52E-01
Pituitary cancer 2D12 Pituitary tissue 5.10E-01 2.16E-01 5.47E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.31E-02 6.06E-01 1.59E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.20E-01 -1.40E-01 -8.85E-01
Polycythemia vera 2A20.4 Whole blood 1.42E-01 3.41E-02 2.49E-01
Pompe disease 5C51.3 Biceps muscle 2.11E-01 3.76E-01 1.54E+00
Preterm birth KA21.4Z Myometrium 4.49E-01 2.26E-01 8.62E-01
Prostate cancer 2C82 Prostate 3.12E-01 -1.32E-02 -2.86E-02
Psoriasis EA90 Skin 3.37E-01 7.19E-02 2.02E-01
Rectal cancer 2B92 Rectal colon tissue 5.77E-03 3.40E-01 1.36E+00
Renal cancer 2C90-2C91 Kidney 6.66E-03 -5.84E-01 -1.43E+00
Retinoblastoma 2D02.2 Uvea 8.78E-08 1.01E+00 5.31E+00
Rheumatoid arthritis FA20 Synovial tissue 5.75E-02 -3.70E-01 -1.21E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.08E-01 -3.43E-02 -1.55E-01
Schizophrenia 6A20 Prefrontal cortex 1.64E-01 4.97E-02 1.67E-01
Schizophrenia 6A20 Superior temporal cortex 4.86E-02 -7.59E-02 -4.04E-01
Scleroderma 4A42.Z Whole blood 1.61E-01 -3.01E-01 -8.98E-01
Seizure 8A60-8A6Z Whole blood 7.38E-01 -6.39E-02 -2.07E-01
Sensitive skin EK0Z Skin 9.82E-01 4.54E-02 1.92E-01
Sepsis with septic shock 1G41 Whole blood 6.33E-15 2.48E-01 8.49E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.42E-03 -3.35E-01 -2.01E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.73E-05 -3.48E-01 -1.86E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.54E-01 8.85E-02 1.31E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.65E-01 6.56E-03 1.09E-01
Skin cancer 2C30-2C3Z Skin 2.87E-05 3.13E-01 5.65E-01
Thrombocythemia 3B63 Whole blood 1.10E-02 1.39E-01 9.42E-01
Thrombocytopenia 3B64 Whole blood 9.73E-01 1.14E-01 3.17E-01
Thyroid cancer 2D10 Thyroid 3.58E-10 3.99E-01 1.03E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.98E-01 -2.36E-01 -6.85E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.36E-03 7.73E-01 3.82E+00
Type 2 diabetes 5A11 Liver tissue 4.87E-01 -4.81E-03 -2.28E-02
Ureter cancer 2C92 Urothelium 7.20E-01 -6.49E-02 -3.78E-01
Uterine cancer 2C78 Endometrium tissue 2.94E-01 7.89E-02 1.39E-01
Vitiligo ED63.0 Skin 9.86E-01 -2.93E-01 -7.51E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 An atlas of human metabolism. Sci Signal. 2020 Mar 24;13(624). pii: eaaz1482. (Reaction HMR_6507)