Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DER8LQ6)

DME Name Phenylethanolamine N-methyltransferase (PNMT)
Synonyms Noradrenaline N-methyltransferase; PNMTase; PENT; PNMT
Gene Name PNMT
UniProt ID
PNMT_HUMAN
INTEDE ID
DME0543
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5409
EC Number EC: 2.1.1.28
Transferase
Methylase
Methyltransferase
EC: 2.1.1.28
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGA
FNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVR
EALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
Function This enzyme converts noradrenaline to adrenaline.
KEGG Pathway
Metabolic pathways (hsa01100 )
Tyrosine metabolism (hsa00350 )
Reactome Pathway
Catecholamine biosynthesis (R-HSA-209905 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phenylethanolamine DMQD2IA N. A. N. A. Investigative [2]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.30E-01 -7.11E-02 -2.62E-01
Alopecia ED70 Skin from scalp 6.23E-01 9.13E-03 4.02E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.46E-01 -7.60E-03 -2.66E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 6.61E-01 -1.63E-03 -1.15E-02
Aortic stenosis BB70 Calcified aortic valve 7.88E-01 -1.30E-01 -2.48E-01
Apnea 7A40 Hyperplastic tonsil 6.26E-01 -5.15E-02 -3.25E-01
Arthropathy FA00-FA5Z Peripheral blood 1.84E-01 3.62E-02 2.34E-01
Asthma CA23 Nasal and bronchial airway 9.16E-03 -1.11E-01 -2.57E-01
Atopic dermatitis EA80 Skin 2.96E-01 3.16E-02 2.02E-01
Autism 6A02 Whole blood 2.03E-01 -3.62E-02 -1.30E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.10E-01 -1.80E-01 -2.36E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.97E-01 -4.94E-03 -4.37E-02
Bacterial infection of gingival 1C1H Gingival tissue 5.44E-01 -4.80E-02 -2.21E-01
Batten disease 5C56.1 Whole blood 6.65E-01 1.01E-01 1.02E+00
Behcet's disease 4A62 Peripheral blood 9.00E-01 -9.20E-02 -4.47E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.73E-03 -1.86E-01 -8.44E-01
Bladder cancer 2C94 Bladder tissue 9.98E-03 3.34E-02 1.44E-01
Breast cancer 2C60-2C6Z Breast tissue 2.18E-26 2.07E-01 4.35E-01
Cardioembolic stroke 8B11.20 Whole blood 2.52E-02 1.40E-01 7.13E-01
Cervical cancer 2C77 Cervical tissue 9.75E-01 -2.32E-02 -1.19E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.75E-01 2.28E-02 6.75E-02
Chronic hepatitis C 1E51.1 Whole blood 9.67E-01 -6.32E-05 -4.25E-04
Chronic obstructive pulmonary disease CA22 Lung tissue 8.92E-01 1.74E-02 6.96E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.24E-01 7.62E-02 2.93E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.03E-01 -4.38E-02 -4.29E-01
Colon cancer 2B90 Colon tissue 6.76E-01 4.95E-03 2.15E-02
Coronary artery disease BA80-BA8Z Peripheral blood 5.95E-01 -1.00E-02 -2.53E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.01E-01 -1.10E-01 -4.77E-01
Endometriosis GA10 Endometrium tissue 2.24E-01 -1.33E-01 -5.43E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.44E-01 -2.52E-03 -1.40E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.76E-04 -4.18E-01 -1.28E+00
Gastric cancer 2B72 Gastric tissue 5.08E-01 1.08E-01 4.18E-01
Glioblastopma 2A00.00 Nervous tissue 1.36E-30 -3.68E-01 -1.10E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.82E-01 -1.82E-01 -7.03E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.77E-06 -7.54E-01 -2.96E+00
Head and neck cancer 2D42 Head and neck tissue 3.14E-02 1.08E-01 4.59E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.58E-01 -1.97E-02 -4.87E-02
Huntington's disease 8A01.10 Whole blood 6.93E-02 1.36E-01 5.87E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.35E-02 -7.11E-01 -1.04E+00
Immunodeficiency 4A00-4A20 Peripheral blood 7.76E-01 1.66E-03 1.93E-02
Influenza 1E30 Whole blood 5.45E-03 2.56E-01 2.30E+00
Interstitial cystitis GC00.3 Bladder tissue 5.19E-02 -2.78E-01 -1.33E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.35E-03 -3.17E-01 -9.04E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.90E-01 -9.82E-03 -4.74E-02
Ischemic stroke 8B11 Peripheral blood 4.89E-01 -5.50E-02 -6.37E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.07E-01 -8.16E-03 -3.05E-02
Lateral sclerosis 8B60.4 Skin 7.65E-01 5.51E-02 3.03E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.66E-01 7.96E-02 3.07E-01
Liver cancer 2C12.0 Liver tissue 4.46E-03 -2.24E-01 -8.54E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.80E-02 -3.03E-01 -1.24E+00
Lung cancer 2C25 Lung tissue 6.49E-10 -1.17E-01 -3.97E-01
Lupus erythematosus 4A40 Whole blood 2.49E-01 -9.45E-02 -2.09E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.54E-01 -6.06E-02 -2.68E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.18E-02 -1.93E-02 -9.78E-02
Melanoma 2C30 Skin 1.02E-01 -9.11E-02 -2.88E-01
Multiple myeloma 2A83.1 Peripheral blood 4.13E-01 -6.95E-02 -5.47E-01
Multiple myeloma 2A83.1 Bone marrow 1.40E-01 -2.05E-01 -8.47E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.84E-01 2.21E-02 6.95E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.26E-02 5.88E-02 1.78E-01
Myelofibrosis 2A20.2 Whole blood 1.57E-01 5.19E-02 3.87E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.64E-01 4.04E-01 7.73E-01
Myopathy 8C70.6 Muscle tissue 8.48E-02 -1.70E-01 -1.51E+00
Neonatal sepsis KA60 Whole blood 2.58E-01 -5.39E-02 -1.64E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.93E-01 -2.70E-01 -7.84E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.38E-01 -5.29E-02 -3.71E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.18E-01 2.97E-02 1.38E-01
Olive pollen allergy CA08.00 Peripheral blood 4.44E-02 1.78E-01 1.28E+00
Oral cancer 2B6E Oral tissue 2.35E-07 -3.38E-01 -1.05E+00
Osteoarthritis FA00-FA0Z Synovial tissue 4.20E-01 9.64E-02 2.32E-01
Osteoporosis FB83.1 Bone marrow 2.50E-01 1.93E-01 6.60E-01
Ovarian cancer 2C73 Ovarian tissue 5.62E-01 -1.90E-01 -7.10E-01
Pancreatic cancer 2C10 Pancreas 7.06E-02 -1.48E-01 -4.19E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.20E-01 2.46E-02 5.61E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.81E-02 -1.27E-01 -6.43E-01
Pituitary cancer 2D12 Pituitary tissue 7.40E-02 -5.92E-01 -5.16E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.12E-01 -4.08E-01 -3.47E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.14E-01 8.46E-02 3.54E-01
Polycythemia vera 2A20.4 Whole blood 3.99E-02 5.41E-02 3.27E-01
Pompe disease 5C51.3 Biceps muscle 2.05E-05 -8.24E-01 -2.48E+00
Preterm birth KA21.4Z Myometrium 6.81E-01 1.73E-03 1.02E-02
Prostate cancer 2C82 Prostate 4.69E-01 -1.26E-01 -3.05E-01
Psoriasis EA90 Skin 2.70E-03 -1.90E-01 -5.01E-01
Rectal cancer 2B92 Rectal colon tissue 3.37E-01 9.42E-02 5.96E-01
Renal cancer 2C90-2C91 Kidney 8.96E-02 -2.59E-01 -8.65E-01
Retinoblastoma 2D02.2 Uvea 1.54E-01 -2.93E-02 -1.89E-01
Rheumatoid arthritis FA20 Synovial tissue 5.30E-02 -3.27E-01 -6.62E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.60E-01 3.85E-02 2.85E-01
Schizophrenia 6A20 Prefrontal cortex 3.09E-01 -4.99E-02 -1.58E-01
Schizophrenia 6A20 Superior temporal cortex 6.91E-01 4.62E-02 2.93E-01
Scleroderma 4A42.Z Whole blood 7.83E-03 3.06E-01 1.40E+00
Seizure 8A60-8A6Z Whole blood 3.31E-01 -4.53E-02 -2.26E-01
Sensitive skin EK0Z Skin 2.74E-01 6.58E-03 5.61E-02
Sepsis with septic shock 1G41 Whole blood 2.19E-01 4.43E-02 1.60E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.45E-01 2.80E-02 1.11E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.71E-01 -1.14E-03 -5.62E-03
Simpson golabi behmel syndrome LD2C Adipose tissue 7.20E-01 9.76E-03 1.36E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.79E-01 -1.32E-01 -2.97E-01
Skin cancer 2C30-2C3Z Skin 2.68E-08 -1.61E-01 -4.11E-01
Thrombocythemia 3B63 Whole blood 9.69E-01 -7.17E-04 -5.15E-03
Thrombocytopenia 3B64 Whole blood 3.72E-01 -5.93E-02 -1.37E-01
Thyroid cancer 2D10 Thyroid 1.68E-23 3.18E-01 1.34E+00
Tibial muscular dystrophy 8C75 Muscle tissue 5.02E-01 4.95E-02 2.39E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.67E-01 -3.31E-01 -1.34E+00
Type 2 diabetes 5A11 Liver tissue 3.24E-01 -8.31E-05 -7.00E-04
Ureter cancer 2C92 Urothelium 6.69E-01 2.02E-02 9.14E-02
Uterine cancer 2C78 Endometrium tissue 2.69E-03 -9.57E-02 -2.82E-01
Vitiligo ED63.0 Skin 2.81E-01 2.11E-02 2.75E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Phenylethanolamine N-methyltransferase (PNMT) DTT Info
DME DTT Type Literature-reported
1 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
LY134046 DMT0JXC Discovery agent N.A. Investigative [1]

References

1 Properties of 8,9-dichloro-2,3,4,5-tetrahydro-1H-2-benzazepine, an inhibitor of norepinephrine N-methyltransferase. Biochem Pharmacol. 1981 Jun 1;30(11):1345-52.
2 Structural, mutagenic, and kinetic analysis of the binding of substrates and inhibitors of human phenylethanolamine N-methyltransferase. J Med Chem. 2005 Nov 17;48(23):7243-52.