Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DERG61P)

DME Name Fucosyltransferase XI (FUT11)
Synonyms Galactoside 3-L-fucosyltransferase 11; Alpha-(1,3)-fucosyltransferase 11; Fucosyltransferase 11; FUT11; Fuc-TXI; FucT-XI
Gene Name FUT11
UniProt ID
FUT11_HUMAN
INTEDE ID
DME0527
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
170384
EC Number EC: 2.4.1.152
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.152
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAAGPIRVVLVLLGVLSVCAASGHGSVAEREAGGEAEWAEPWDGAVFRPPSALGAVGVTR
SSGTPRPGREEAGDLPVLLWWSPGLFPHFPGDSERIECARGACVASRNRRALRDSRTRAL
LFYGTDFRASAAPLPRLAHQSWALLHEESPLNNFLLSHGPGIRLFNLTSTFSRHSDYPLS
LQWLPGTAYLRRPVPPPMERAEWRRRGYAPLLYLQSHCDVPADRDRYVRELMRHIPVDSY
GKCLQNRELPTARLQDTATATTEDPELLAFLSRYKFHLALENAICNDYMTEKLWRPMHLG
AVPVYRGSPSVRDWMPNNHSVILIDDFESPQKLAEFIDFLDKNDEEYMKYLAYKQPGGIT
NQFLLDSLKHREWGVNDPLLPNYLNGFECFVCDYELARLDAEKAHAASPGDSPVFEPHIA
QPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQDYWQGLDQGEALTAMIHNNETEQTKFWD
YLHEIFMKRQHL
Function This enzyme is a probable fucosyltransferase.
Reactome Pathway
Lewis blood group biosynthesis (R-HSA-9037629 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
GDP-l-fucose DM9ARQ1 N. A. N. A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.03E-01 -4.16E-04 -9.02E-04
Alopecia ED70 Skin from scalp 8.44E-01 -2.85E-03 -1.48E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.77E-04 -7.79E-02 -3.97E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.53E-01 7.01E-02 2.62E-01
Aortic stenosis BB70 Calcified aortic valve 6.39E-01 2.18E-01 3.66E-01
Apnea 7A40 Hyperplastic tonsil 7.55E-01 -1.41E-01 -6.68E-01
Arthropathy FA00-FA5Z Peripheral blood 6.56E-04 -2.31E-01 -1.00E+00
Asthma CA23 Nasal and bronchial airway 7.76E-01 -8.18E-03 -2.59E-02
Atopic dermatitis EA80 Skin 1.72E-01 -2.98E-02 -1.56E-01
Autism 6A02 Whole blood 7.65E-02 -3.57E-02 -1.10E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.72E-01 -1.52E-01 -7.55E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.81E-01 -1.93E-01 -4.93E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.45E-01 5.88E-02 2.14E-01
Batten disease 5C56.1 Whole blood 7.52E-01 -1.43E-01 -5.42E-01
Behcet's disease 4A62 Peripheral blood 9.63E-01 -3.99E-04 -1.23E-03
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.80E-01 1.64E-02 9.95E-02
Bladder cancer 2C94 Bladder tissue 1.13E-02 -2.72E-01 -1.15E+00
Breast cancer 2C60-2C6Z Breast tissue 9.84E-01 -4.14E-02 -1.02E-01
Cardioembolic stroke 8B11.20 Whole blood 4.44E-03 2.38E-01 7.29E-01
Cervical cancer 2C77 Cervical tissue 1.25E-01 -1.85E-01 -3.36E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.09E-01 -1.66E-01 -2.16E-01
Chronic hepatitis C 1E51.1 Whole blood 2.09E-01 -1.48E-01 -1.83E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.73E-01 -6.38E-02 -2.10E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.87E-02 -1.14E-01 -5.56E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.30E-01 1.88E-01 8.23E-01
Colon cancer 2B90 Colon tissue 4.83E-08 1.40E-01 4.20E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.49E-02 2.90E-01 1.07E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.31E-01 -8.45E-02 -1.25E-01
Endometriosis GA10 Endometrium tissue 8.25E-02 1.42E-01 2.59E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.48E-01 -1.43E-01 -3.60E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.62E-02 -1.61E-01 -6.19E-01
Gastric cancer 2B72 Gastric tissue 1.79E-02 8.84E-01 4.36E+00
Glioblastopma 2A00.00 Nervous tissue 5.37E-24 1.67E-01 6.42E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.85E-01 2.60E-01 7.29E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.23E-03 7.39E-01 1.68E+00
Head and neck cancer 2D42 Head and neck tissue 1.99E-21 6.27E-01 1.48E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.28E-01 -8.20E-03 -5.92E-02
Huntington's disease 8A01.10 Whole blood 5.89E-02 -3.36E-01 -8.32E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.57E-01 -3.69E-02 -3.46E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.38E-02 5.17E-02 4.32E-01
Influenza 1E30 Whole blood 2.15E-02 -5.36E-01 -1.70E+00
Interstitial cystitis GC00.3 Bladder tissue 5.32E-02 1.97E-01 1.42E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.30E-07 6.54E-01 2.12E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.28E-01 4.55E-02 1.56E-01
Ischemic stroke 8B11 Peripheral blood 3.23E-02 -3.06E-01 -8.95E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.15E-11 -2.32E-01 -1.14E+00
Lateral sclerosis 8B60.4 Skin 1.32E-01 -2.91E-01 -9.54E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.79E-01 1.36E-01 6.12E-01
Liver cancer 2C12.0 Liver tissue 8.71E-02 7.46E-02 2.36E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.40E-02 3.35E-01 1.12E+00
Lung cancer 2C25 Lung tissue 4.79E-01 -4.00E-02 -1.42E-01
Lupus erythematosus 4A40 Whole blood 5.65E-02 -5.70E-02 -1.39E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.07E-01 2.47E-02 1.57E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.57E-01 -2.37E-03 -6.73E-03
Melanoma 2C30 Skin 5.41E-01 2.93E-01 4.01E-01
Multiple myeloma 2A83.1 Peripheral blood 3.05E-01 6.49E-01 7.70E-01
Multiple myeloma 2A83.1 Bone marrow 7.63E-02 -1.35E-02 -1.41E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.41E-01 -5.92E-02 -2.26E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.47E-05 3.02E-01 9.16E-01
Myelofibrosis 2A20.2 Whole blood 9.44E-01 -1.67E-02 -1.29E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.09E-02 -1.45E-01 -2.17E-01
Myopathy 8C70.6 Muscle tissue 3.94E-03 2.62E-01 1.51E+00
Neonatal sepsis KA60 Whole blood 1.16E-09 -3.62E-01 -9.60E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.04E-03 3.99E-01 1.36E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.76E-01 1.76E-03 1.37E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.43E-01 -1.68E-01 -7.26E-01
Olive pollen allergy CA08.00 Peripheral blood 8.87E-02 -4.00E-01 -1.56E+00
Oral cancer 2B6E Oral tissue 1.59E-03 2.23E-01 5.30E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.32E-01 2.16E-01 3.51E-01
Osteoporosis FB83.1 Bone marrow 1.51E-01 3.97E-01 1.03E+00
Ovarian cancer 2C73 Ovarian tissue 1.03E-01 3.20E-01 5.97E-01
Pancreatic cancer 2C10 Pancreas 2.38E-04 4.77E-01 1.50E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.43E-01 2.14E-01 6.01E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.09E-01 -1.05E-01 -3.48E-01
Pituitary cancer 2D12 Pituitary tissue 6.53E-01 -1.42E-01 -3.47E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.02E-03 -4.70E-01 -1.58E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.11E-01 -7.68E-02 -4.08E-01
Polycythemia vera 2A20.4 Whole blood 2.79E-06 -1.86E-01 -1.26E+00
Pompe disease 5C51.3 Biceps muscle 1.54E-04 4.21E-01 3.00E+00
Preterm birth KA21.4Z Myometrium 1.16E-01 -4.33E-01 -1.62E+00
Prostate cancer 2C82 Prostate 1.35E-01 6.40E-01 7.16E-01
Psoriasis EA90 Skin 9.54E-10 -3.64E-01 -1.04E+00
Rectal cancer 2B92 Rectal colon tissue 9.83E-02 7.73E-02 1.11E+00
Renal cancer 2C90-2C91 Kidney 3.58E-12 1.15E+00 5.77E+00
Retinoblastoma 2D02.2 Uvea 8.88E-01 1.56E-01 3.13E-01
Rheumatoid arthritis FA20 Synovial tissue 4.49E-03 5.42E-01 1.32E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.26E-02 3.06E-02 2.06E-01
Schizophrenia 6A20 Prefrontal cortex 5.49E-01 4.06E-02 5.01E-02
Schizophrenia 6A20 Superior temporal cortex 6.62E-01 -2.59E-02 -3.07E-01
Scleroderma 4A42.Z Whole blood 1.31E-03 -4.02E-01 -1.94E+00
Seizure 8A60-8A6Z Whole blood 6.44E-01 -4.89E-02 -2.14E-01
Sensitive skin EK0Z Skin 6.76E-01 -3.70E-02 -3.03E-01
Sepsis with septic shock 1G41 Whole blood 1.38E-34 -5.42E-01 -1.25E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.32E-01 2.21E-01 6.42E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.99E-03 -3.80E-01 -9.97E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.87E-04 2.64E+00 6.04E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.56E-02 5.03E-01 2.16E+00
Skin cancer 2C30-2C3Z Skin 1.00E-01 1.64E-02 4.50E-02
Thrombocythemia 3B63 Whole blood 3.39E-03 -9.22E-02 -6.81E-01
Thrombocytopenia 3B64 Whole blood 1.84E-01 -3.36E-02 -4.80E-02
Thyroid cancer 2D10 Thyroid 9.62E-18 2.61E-01 1.14E+00
Tibial muscular dystrophy 8C75 Muscle tissue 5.02E-06 8.08E-01 1.79E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.81E-01 -1.74E-01 -1.45E+00
Type 2 diabetes 5A11 Liver tissue 9.64E-02 1.96E-01 1.07E+00
Ureter cancer 2C92 Urothelium 8.41E-01 5.58E-02 3.37E-01
Uterine cancer 2C78 Endometrium tissue 1.40E-02 -2.25E-01 -3.98E-01
Vitiligo ED63.0 Skin 3.37E-01 -1.15E-01 -4.61E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Activity, splice variants, conserved peptide motifs, and phylogeny of two new alpha1,3-fucosyltransferase families (FUT10 and FUT11). J Biol Chem. 2009 Feb 13;284(7):4723-38.