Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEROYHE)

DME Name N-acetyl-D-glucosamine 2-epimerase (AGE)
Synonyms GlcNAc 2-epimerase; N-acylglucosamine 2-epimerase; Renin-binding protein; RnBP; AGE; RENBP
Gene Name RENBP
UniProt ID
RENBP_HUMAN
INTEDE ID
DME0576
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
5973
EC Number EC: 5.1.3.8
Isomerase
Racemase/epimerase
Carbohydrate racemase/epimerase
EC: 5.1.3.8
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSKGLPARQDMEKERETLQAWKERVGQELDRVVAFWMEHSHDQEHGGFFTCLGREGRVYD
DLKYVWLQGRQVWMYCRLYRTFERFRHAQLLDAAKAGGEFLLRYARVAPPGKKCAFVLTR
DGRPVKVQRTIFSECFYTMAMNELWRATGEVRYQTEAVEMMDQIVHWVQEDASGLGRPQL
QGAPAAEPMAVPMMLLNLVEQLGEADEELAGKYAELGDWCARRILQHVQRDGQAVLENVS
EGGKELPGCLGRQQNPGHTLEAGWFLLRHCIRKGDPELRAHVIDKFLLLPFHSGWDPDHG
GLFYFQDADNFCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQF
RDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSRPAPAPSPAPT
PACRGAE
Function This enzyme catalyzes the interconversion of N-acetylglucosamine to N- acetylmannosamine. It is involved in the N-glycolylneuraminic acid (Neu5Gc) degradation pathway.
KEGG Pathway
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Synthesis of UDP-N-acetyl-glucosamine (R-HSA-446210 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
N-Acetyl-D-glucosamine DM1XBWR Autoimmune diabetes 5A10 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.47E-09 3.24E-01 7.88E-01
Alopecia ED70 Skin from scalp 2.42E-03 1.06E-01 4.64E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.55E-04 1.38E-01 5.14E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.83E-01 -4.37E-02 -1.17E-01
Aortic stenosis BB70 Calcified aortic valve 5.54E-01 -9.28E-02 -1.97E-01
Apnea 7A40 Hyperplastic tonsil 3.47E-01 -2.90E-01 -8.17E-01
Arthropathy FA00-FA5Z Peripheral blood 8.69E-01 -4.90E-02 -1.72E-01
Asthma CA23 Nasal and bronchial airway 3.54E-01 -1.16E-01 -1.97E-01
Atopic dermatitis EA80 Skin 6.15E-01 -8.10E-02 -2.39E-01
Autism 6A02 Whole blood 1.56E-01 -1.75E-02 -3.62E-02
Autoimmune uveitis 9A96 Peripheral monocyte 7.51E-02 4.43E-01 3.30E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.05E-02 1.19E-01 2.82E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.32E-03 1.83E-01 4.08E-01
Batten disease 5C56.1 Whole blood 3.18E-01 1.93E-01 9.36E-01
Behcet's disease 4A62 Peripheral blood 3.22E-01 3.58E-01 1.02E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.30E-01 -9.90E-02 -4.46E-01
Bladder cancer 2C94 Bladder tissue 1.90E-04 1.16E+00 2.80E+00
Breast cancer 2C60-2C6Z Breast tissue 6.34E-01 -8.96E-02 -1.14E-01
Cardioembolic stroke 8B11.20 Whole blood 8.49E-02 -1.18E-01 -3.87E-01
Cervical cancer 2C77 Cervical tissue 2.16E-02 1.44E-01 5.82E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.47E-01 9.13E-02 1.07E-01
Chronic hepatitis C 1E51.1 Whole blood 1.52E-01 2.02E-01 8.87E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.09E-01 -4.67E-02 -9.80E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.59E-01 1.27E-01 3.96E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.59E-02 2.44E-01 1.23E+00
Colon cancer 2B90 Colon tissue 5.21E-03 -1.22E-01 -3.15E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.43E-01 -1.07E-01 -8.80E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.02E-01 -1.56E-01 -6.44E-01
Endometriosis GA10 Endometrium tissue 2.29E-01 1.33E-01 1.90E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.19E-02 -2.68E-02 -1.30E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.44E-10 7.37E-01 2.24E+00
Gastric cancer 2B72 Gastric tissue 3.37E-01 -2.42E-01 -1.59E+00
Glioblastopma 2A00.00 Nervous tissue 6.20E-04 -3.25E-01 -6.01E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.73E-01 -1.31E-01 -4.66E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.83E-01 -4.10E-02 -1.09E-01
Head and neck cancer 2D42 Head and neck tissue 1.51E-04 1.35E-01 4.74E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.93E-01 5.55E-02 1.61E-01
Huntington's disease 8A01.10 Whole blood 8.13E-01 6.88E-02 1.59E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.75E-02 2.69E-01 9.10E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.05E-02 1.30E-01 1.61E+00
Influenza 1E30 Whole blood 2.22E-01 2.37E-01 1.30E+00
Interstitial cystitis GC00.3 Bladder tissue 3.23E-01 4.30E-01 9.22E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.20E-01 4.83E-01 1.13E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.69E-01 4.45E-02 1.44E-01
Ischemic stroke 8B11 Peripheral blood 4.56E-02 -3.17E-01 -9.73E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.07E-01 -5.50E-02 -1.76E-01
Lateral sclerosis 8B60.4 Skin 3.01E-01 1.60E-01 7.52E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.18E-02 -1.68E-01 -8.02E-01
Liver cancer 2C12.0 Liver tissue 9.74E-01 -8.97E-02 -2.50E-01
Liver failure DB99.7-DB99.8 Liver tissue 9.37E-05 5.51E-01 3.09E+00
Lung cancer 2C25 Lung tissue 5.38E-27 -4.75E-01 -9.09E-01
Lupus erythematosus 4A40 Whole blood 9.34E-01 -2.36E-02 -3.49E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.97E-01 -7.47E-02 -3.48E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.81E-01 -1.77E-02 -3.81E-02
Melanoma 2C30 Skin 1.26E-04 1.84E+00 1.35E+00
Multiple myeloma 2A83.1 Peripheral blood 2.29E-01 1.23E-01 5.47E-01
Multiple myeloma 2A83.1 Bone marrow 5.04E-06 -7.86E-01 -3.85E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.90E-01 9.37E-02 2.70E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.97E-01 4.62E-02 1.30E-01
Myelofibrosis 2A20.2 Whole blood 2.62E-03 -2.57E-01 -1.27E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.27E-02 4.12E-01 6.58E-01
Myopathy 8C70.6 Muscle tissue 2.40E-01 1.64E-01 5.70E-01
Neonatal sepsis KA60 Whole blood 2.03E-17 7.42E-01 1.34E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.03E-07 -2.11E+00 -3.91E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.60E-01 6.26E-03 4.27E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.99E-01 1.02E-01 8.01E-01
Olive pollen allergy CA08.00 Peripheral blood 1.62E-04 5.10E-01 7.21E+00
Oral cancer 2B6E Oral tissue 2.13E-03 -4.00E-01 -1.05E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.07E-01 -1.30E-02 -3.14E-02
Osteoporosis FB83.1 Bone marrow 5.63E-02 3.47E-01 2.55E+00
Ovarian cancer 2C73 Ovarian tissue 3.51E-01 8.00E-03 1.72E-02
Pancreatic cancer 2C10 Pancreas 6.42E-01 -9.03E-02 -1.87E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.00E-01 -1.49E-01 -5.39E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.37E-04 4.38E-01 1.16E+00
Pituitary cancer 2D12 Pituitary tissue 9.65E-01 1.14E-01 2.41E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.64E-01 -6.47E-02 -1.34E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.69E-01 -2.82E-02 -2.61E-01
Polycythemia vera 2A20.4 Whole blood 3.00E-03 -1.13E-01 -5.52E-01
Pompe disease 5C51.3 Biceps muscle 5.74E-02 1.60E-01 1.37E+00
Preterm birth KA21.4Z Myometrium 6.35E-01 -1.01E-01 -2.90E-01
Prostate cancer 2C82 Prostate 3.50E-07 -1.63E+00 -2.08E+00
Psoriasis EA90 Skin 3.68E-12 -4.02E-01 -5.51E-01
Rectal cancer 2B92 Rectal colon tissue 1.07E-02 -3.44E-01 -1.58E+00
Renal cancer 2C90-2C91 Kidney 1.17E-02 -1.09E+00 -1.23E+00
Retinoblastoma 2D02.2 Uvea 1.03E-09 2.15E+00 9.31E+00
Rheumatoid arthritis FA20 Synovial tissue 7.78E-04 1.11E+00 3.01E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.30E-01 1.89E-02 1.35E-01
Schizophrenia 6A20 Prefrontal cortex 5.81E-01 1.75E-01 3.06E-01
Schizophrenia 6A20 Superior temporal cortex 1.34E-01 -1.07E-01 -5.80E-01
Scleroderma 4A42.Z Whole blood 3.10E-02 1.34E-01 5.94E-01
Seizure 8A60-8A6Z Whole blood 5.90E-01 -9.41E-03 -3.46E-02
Sensitive skin EK0Z Skin 5.90E-01 1.95E-02 7.15E-02
Sepsis with septic shock 1G41 Whole blood 2.07E-41 5.02E-01 1.45E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.25E-01 3.25E-01 1.09E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.72E-02 6.85E-02 3.13E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.65E-01 1.71E-02 4.63E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.16E-01 -3.94E-02 -1.71E-01
Skin cancer 2C30-2C3Z Skin 2.47E-08 3.96E-01 4.54E-01
Thrombocythemia 3B63 Whole blood 1.54E-02 -1.40E-01 -7.19E-01
Thrombocytopenia 3B64 Whole blood 8.18E-01 -2.38E-01 -4.42E-01
Thyroid cancer 2D10 Thyroid 1.46E-20 4.82E-01 1.32E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.46E-01 3.55E-02 1.60E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.78E-02 1.02E+00 3.93E+00
Type 2 diabetes 5A11 Liver tissue 4.99E-01 -1.36E-01 -2.83E-01
Ureter cancer 2C92 Urothelium 6.76E-01 6.77E-03 2.75E-02
Uterine cancer 2C78 Endometrium tissue 9.73E-01 -5.15E-02 -1.04E-01
Vitiligo ED63.0 Skin 6.65E-01 1.50E-01 4.67E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name N-acylglucosamine 2-epimerase (RENBP) DTT Info
DME DTT Type Literature-reported

References

1 Production of N-acetyl-d-neuraminic acid by whole cells expressing Bacteroides thetaiotaomicron N-acetyl-d-glucosamine 2-epimerase and Escherichia coli N-acetyl-d-neuraminic acid aldolase. J Agric Food Chem. 2019 Jun 5;67(22):6285-6291.