Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DERQ52Z)

DME Name Glutathione S-transferase mu-4 (GSTM4)
Synonyms Glutathione S-transferase Mu 4; GST class-mu 4; GST-Mu2; GSTM4; GSTM4-4
Gene Name GSTM4
UniProt ID
GSTM4_HUMAN
INTEDE ID
DME0613
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
2948
EC Number EC: 2.5.1.18
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.18
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDF
EKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
Function This enzyme actives on 1-chloro-2,4-dinitrobenzene and it conjugates of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Fluid shear stress and atherosclerosis (hsa05418 )
Glutathione metabolism (hsa00480 )
Hepatocellular carcinoma (hsa05225 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pathways in cancer (hsa05200 )
Platinum drug resistance (hsa01524 )
Reactome Pathway
Glutathione conjugation (R-HSA-156590 )
Biosynthesis of maresin conjugates in tissue regeneration (MCTR) (R-HSA-9026762 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Amodiaquine DME4RA8 Malaria 1F40-1F45 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.78E-09 3.14E-01 7.38E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.01E-03 9.42E-02 3.56E-01
Asthma CA23 Nasal and bronchial airway 2.87E-01 -2.08E-02 -2.94E-02
Behcet's disease 4A62 Peripheral blood 8.39E-01 -7.56E-02 -1.48E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.23E-01 4.85E-02 1.23E-01
Bladder cancer 2C94 Bladder tissue 2.51E-01 -4.39E-01 -7.94E-01
Breast cancer 2C60-2C6Z Breast tissue 7.17E-28 -4.01E-01 -1.00E+00
Colon cancer 2B90 Colon tissue 4.48E-84 -1.20E+00 -2.76E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.12E-01 -2.90E-01 -2.03E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.70E-01 -3.32E-01 -1.52E+00
Gastric cancer 2B72 Gastric tissue 5.54E-01 -4.66E-01 -8.89E-01
Glioblastopma 2A00.00 Nervous tissue 5.95E-08 -1.78E-01 -3.79E-01
Head and neck cancer 2D42 Head and neck tissue 2.11E-08 -5.18E-01 -1.28E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.58E-01 -1.55E-01 -4.91E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.00E-01 1.95E-01 5.87E-01
Interstitial cystitis GC00.3 Bladder tissue 6.33E-01 -1.71E-01 -2.38E-01
Ischemic stroke 8B11 Peripheral blood 2.82E-01 -4.86E-02 -7.39E-02
Liver cancer 2C12.0 Liver tissue 8.31E-01 -1.43E-01 -2.25E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.63E-01 1.06E-01 3.53E-01
Lung cancer 2C25 Lung tissue 8.97E-10 -3.59E-01 -7.80E-01
Lupus erythematosus 4A40 Whole blood 9.40E-01 -3.49E-02 -4.88E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.24E-01 -1.05E-01 -2.63E-01
Multiple myeloma 2A83.1 Bone marrow 9.48E-02 -1.02E-01 -9.52E-01
Multiple myeloma 2A83.1 Peripheral blood 7.49E-01 4.83E-02 1.10E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.67E-02 3.31E-01 5.15E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.41E-02 8.87E-02 2.35E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.35E-01 -4.99E-02 -5.72E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.09E-09 -1.04E+00 -4.58E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.61E-01 3.61E-02 1.27E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.85E-01 1.34E-01 7.87E-01
Olive pollen allergy CA08.00 Peripheral blood 8.30E-01 5.80E-02 3.27E-01
Oral cancer 2B6E Oral tissue 3.74E-03 -5.34E-01 -1.20E+00
Ovarian cancer 2C73 Ovarian tissue 2.45E-03 -1.34E+00 -1.96E+00
Pancreatic cancer 2C10 Pancreas 1.09E-02 2.39E-01 6.64E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.00E-02 3.09E-01 1.35E+00
Pituitary cancer 2D12 Pituitary tissue 2.04E-02 6.46E-01 1.60E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.42E-01 9.73E-02 5.78E-01
Pompe disease 5C51.3 Biceps muscle 2.74E-03 -4.33E-01 -1.22E+00
Prostate cancer 2C82 Prostate 2.48E-01 -1.52E-02 -2.54E-02
Psoriasis EA90 Skin 6.10E-03 1.57E-01 3.40E-01
Rectal cancer 2B92 Rectal colon tissue 7.78E-04 -1.38E+00 -2.99E+00
Renal cancer 2C90-2C91 Kidney 3.36E-03 -4.16E-01 -9.90E-01
Retinoblastoma 2D02.2 Uvea 8.95E-05 6.29E-01 2.01E+00
Schizophrenia 6A20 Prefrontal cortex 7.74E-01 2.32E-02 6.10E-02
Schizophrenia 6A20 Superior temporal cortex 5.06E-01 -3.38E-02 -1.79E-01
Scleroderma 4A42.Z Whole blood 2.37E-01 -1.50E-01 -3.41E-01
Seizure 8A60-8A6Z Whole blood 6.16E-01 1.18E-01 2.64E-01
Sepsis with septic shock 1G41 Whole blood 5.04E-02 -8.80E-02 -2.38E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.84E-01 1.19E-01 4.60E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.35E-01 1.17E-01 3.84E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.87E-01 6.46E-02 5.75E-01
Skin cancer 2C30-2C3Z Skin 2.11E-10 4.20E-01 9.04E-01
Thrombocythemia 3B63 Whole blood 3.44E-03 -2.71E-01 -8.85E-01
Thrombocytopenia 3B64 Whole blood 9.70E-01 7.17E-01 5.55E-01
Thyroid cancer 2D10 Thyroid 6.38E-17 -7.95E-01 -1.27E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.10E-02 -2.26E-01 -4.56E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.59E-01 -2.07E-01 -7.53E-01
Type 2 diabetes 5A11 Liver tissue 9.95E-02 2.53E-01 1.09E+00
Ureter cancer 2C92 Urothelium 9.18E-01 -6.35E-02 -3.20E-01
Uterine cancer 2C78 Endometrium tissue 2.91E-13 -4.92E-01 -1.13E+00
Vitiligo ED63.0 Skin 2.49E-01 -1.45E-01 -4.17E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 61 Diseases

References

1 Human glutathione S-transferases- and NAD(P)H:quinone oxidoreductase 1-catalyzed inactivation of reactive quinoneimines of amodiaquine and N-desethylamodiaquine: possible implications for susceptibility to amodiaquine-induced liver toxicity. Toxicol Lett. 2017 Jun 5;275:83-91.