Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DERQCJM)

DME Name Hexosephosphate aminotransferase 2 (GFPT2)
Synonyms Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2; Glutamine:fructose-6-phosphate amidotransferase 2; D-fructose-6-phosphate amidotransferase 2; GFAT 2; GFAT2; GFPT2
Gene Name GFPT2
UniProt ID
GFPT2_HUMAN
INTEDE ID
DME0156
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
9945
EC Number EC: 2.6.1.16
Transferase
Transaminase
Transaminase
EC: 2.6.1.16
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSVHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMK
RLDSSACLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE
Function This enzyme is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.
KEGG Pathway
Alanine, aspartate and glutamate metabolism (hsa00250 )
Amino sugar and nucleotide sugar metabolism (hsa00520 )
Insulin resistance (hsa04931 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Synthesis of UDP-N-acetyl-glucosamine (R-HSA-446210 )

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.42E-01 -3.69E-02 -1.22E-01
Alopecia ED70 Skin from scalp 1.37E-04 3.58E-01 7.60E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.15E-07 2.68E-01 6.88E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.85E-01 -2.01E-03 -1.07E-02
Aortic stenosis BB70 Calcified aortic valve 6.29E-01 2.52E-02 2.56E-02
Apnea 7A40 Hyperplastic tonsil 2.81E-01 -1.29E-01 -1.93E-01
Arthropathy FA00-FA5Z Peripheral blood 5.93E-02 -5.94E-02 -3.13E-01
Asthma CA23 Nasal and bronchial airway 6.74E-01 -9.90E-03 -2.31E-02
Atopic dermatitis EA80 Skin 4.86E-03 -2.50E-01 -6.78E-01
Autism 6A02 Whole blood 5.87E-01 -6.98E-02 -2.60E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.50E-01 -8.71E-02 -4.38E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.86E-01 4.82E-03 2.13E-02
Bacterial infection of gingival 1C1H Gingival tissue 6.99E-05 3.57E-01 6.69E-01
Batten disease 5C56.1 Whole blood 2.07E-01 3.88E-01 1.70E+00
Behcet's disease 4A62 Peripheral blood 8.05E-01 -4.08E-02 -1.36E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.36E-01 1.71E-01 6.22E-01
Bladder cancer 2C94 Bladder tissue 5.39E-01 -2.95E-01 -5.24E-01
Breast cancer 2C60-2C6Z Breast tissue 6.89E-08 -5.16E-01 -6.08E-01
Cardioembolic stroke 8B11.20 Whole blood 1.23E-05 6.60E-01 1.43E+00
Cervical cancer 2C77 Cervical tissue 9.45E-01 -1.63E-01 -5.26E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.14E-01 1.13E-01 4.09E-01
Chronic hepatitis C 1E51.1 Whole blood 5.40E-01 8.05E-02 1.18E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.96E-01 2.02E-02 1.99E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.22E-01 2.33E-02 9.16E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.29E-01 -7.81E-02 -1.79E-01
Colon cancer 2B90 Colon tissue 9.78E-39 5.43E-01 1.16E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.63E-01 -1.03E-01 -9.04E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.11E-01 4.92E-02 2.03E-01
Endometriosis GA10 Endometrium tissue 1.14E-06 5.16E-01 1.02E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.63E-01 -6.22E-02 -3.33E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.79E-08 -6.59E-01 -1.75E+00
Gastric cancer 2B72 Gastric tissue 5.86E-01 5.10E-01 3.79E-01
Glioblastopma 2A00.00 Nervous tissue 9.24E-42 6.24E-01 1.21E+00
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 3.49E-01 9.87E-01 1.35E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.73E-02 1.62E+00 1.41E+00
Head and neck cancer 2D42 Head and neck tissue 1.29E-30 1.39E+00 2.17E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.82E-01 8.84E-02 3.04E-01
Huntington's disease 8A01.10 Whole blood 8.56E-01 1.02E-01 7.18E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.74E-02 -8.21E-01 -8.02E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.97E-01 -2.17E-02 -1.34E-01
Influenza 1E30 Whole blood 1.79E-01 -1.08E+00 -1.10E+00
Interstitial cystitis GC00.3 Bladder tissue 4.05E-01 2.95E-01 8.01E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.70E-02 1.67E+00 1.95E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.72E-02 5.41E-02 1.45E-01
Ischemic stroke 8B11 Peripheral blood 7.63E-01 2.97E-03 1.31E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 7.08E-01 -3.60E-02 -1.05E-01
Lateral sclerosis 8B60.4 Skin 1.80E-01 -2.52E-01 -8.79E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.73E-02 -4.22E-01 -2.00E+00
Liver cancer 2C12.0 Liver tissue 3.53E-01 -1.82E-01 -3.67E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.94E-01 5.66E-01 4.88E-01
Lung cancer 2C25 Lung tissue 2.09E-02 9.41E-02 9.36E-02
Lupus erythematosus 4A40 Whole blood 6.79E-01 1.68E-02 5.17E-02
Major depressive disorder 6A70-6A7Z Hippocampus 1.73E-01 -5.06E-02 -1.88E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.66E-01 -2.72E-02 -5.87E-02
Melanoma 2C30 Skin 4.16E-01 -3.81E-01 -4.27E-01
Multiple myeloma 2A83.1 Peripheral blood 2.57E-02 7.79E-02 3.68E-01
Multiple myeloma 2A83.1 Bone marrow 6.01E-03 -2.02E-01 -1.42E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.19E-01 -2.37E-01 -5.45E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.24E-01 -1.40E-02 -4.34E-02
Myelofibrosis 2A20.2 Whole blood 2.66E-01 -1.02E-02 -6.63E-02
Myocardial infarction BA41-BA50 Peripheral blood 5.49E-02 1.10E-01 1.52E-01
Myopathy 8C70.6 Muscle tissue 6.84E-01 3.07E-02 3.84E-02
Neonatal sepsis KA60 Whole blood 3.38E-02 -7.88E-02 -2.77E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.74E-03 -8.79E-01 -1.83E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.10E-01 3.35E-01 3.80E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.64E-01 1.66E-02 4.62E-02
Olive pollen allergy CA08.00 Peripheral blood 4.58E-01 -3.50E-01 -2.83E-01
Oral cancer 2B6E Oral tissue 4.88E-09 7.69E-01 1.59E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.93E-01 4.86E-01 3.56E-01
Osteoporosis FB83.1 Bone marrow 1.23E-01 -4.99E-01 -1.20E+00
Ovarian cancer 2C73 Ovarian tissue 9.23E-03 -1.26E+00 -9.36E-01
Pancreatic cancer 2C10 Pancreas 1.39E-02 -1.34E-01 -1.27E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.67E-03 4.22E-01 9.58E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.59E-01 -6.94E-02 -4.19E-01
Pituitary cancer 2D12 Pituitary tissue 6.74E-03 -4.61E-01 -1.03E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.00E-02 -6.71E-01 -1.15E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.89E-01 3.72E-02 2.33E-01
Polycythemia vera 2A20.4 Whole blood 8.51E-03 9.37E-02 6.95E-01
Pompe disease 5C51.3 Biceps muscle 6.14E-02 -3.51E-01 -8.12E-01
Preterm birth KA21.4Z Myometrium 2.45E-02 -1.31E+00 -1.72E+00
Prostate cancer 2C82 Prostate 6.15E-01 3.51E-01 3.41E-01
Psoriasis EA90 Skin 4.96E-01 -1.14E-01 -2.08E-01
Rectal cancer 2B92 Rectal colon tissue 8.43E-02 1.76E-01 4.41E-01
Renal cancer 2C90-2C91 Kidney 8.96E-04 2.77E-01 9.44E-01
Retinoblastoma 2D02.2 Uvea 5.27E-05 1.24E+00 5.10E+00
Rheumatoid arthritis FA20 Synovial tissue 2.73E-01 -4.33E-01 -3.16E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.71E-01 -3.81E-03 -2.43E-02
Schizophrenia 6A20 Prefrontal cortex 1.81E-01 -3.35E-02 -4.39E-02
Schizophrenia 6A20 Superior temporal cortex 1.12E-01 6.88E-02 5.56E-01
Scleroderma 4A42.Z Whole blood 7.88E-01 -7.09E-02 -2.59E-01
Seizure 8A60-8A6Z Whole blood 9.59E-01 -9.20E-03 -5.01E-02
Sensitive skin EK0Z Skin 4.89E-02 -2.58E-01 -1.65E+00
Sepsis with septic shock 1G41 Whole blood 5.76E-01 -8.22E-04 -2.70E-03
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.29E-01 4.04E-01 1.09E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.19E-03 2.83E-01 1.14E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 4.83E-01 3.41E-01 6.59E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.78E-02 6.27E-01 2.53E+00
Skin cancer 2C30-2C3Z Skin 1.38E-01 -2.26E-01 -3.31E-01
Thrombocythemia 3B63 Whole blood 7.09E-05 2.48E-01 1.87E+00
Thrombocytopenia 3B64 Whole blood 2.79E-01 6.40E-01 9.66E-01
Thyroid cancer 2D10 Thyroid 4.07E-04 -7.93E-01 -1.58E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.94E-08 1.08E+00 2.63E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.67E-03 6.47E-01 5.46E+00
Type 2 diabetes 5A11 Liver tissue 5.59E-01 -1.23E-01 -5.79E-01
Ureter cancer 2C92 Urothelium 5.93E-01 -1.36E-02 -7.23E-02
Uterine cancer 2C78 Endometrium tissue 7.37E-22 -8.67E-01 -1.24E+00
Vitiligo ED63.0 Skin 4.80E-01 -5.28E-02 -8.68E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases