Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DERQV72)

DME Name VKORC1-like protein 1 (VKORC1L1)
Synonyms Vitamin K epoxide reductase complex subunit 1-like protein 1; VKORC1L1
Gene Name VKORC1L1
UniProt ID
VKORL_HUMAN
INTEDE ID
DME0440
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
154807
EC Number EC: 1.17.4.4
Oxidoreductase
CH/CH2 oxidoreductase
Disulfide acceptor oxidoreductase
EC: 1.17.4.4
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSA
ALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALILMTSSIMS
VVGSLYLAYILYFVLKEFCIICIVTYVLNFLLLIINYKRLVYLNEAWKRQLQPKQD
Function
This enzyme is involved in vitamin K metabolism. It can reduce inactive vitamin K 2,3-epoxide to active vitamin K (in vitro), and may contribute to vitamin K-mediated protection against oxidative stress.
KEGG Pathway
Metabolic pathways (hsa01100 )
Ubiquinone and other terpenoid-quinone biosynthesis (hsa00130 )
Reactome Pathway
Metabolism of vitamin K (R-HSA-6806664 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vitamin K DMN6EZY Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.50E-02 -2.19E-01 -4.56E-01
Alopecia ED70 Skin from scalp 1.71E-02 1.71E-01 6.67E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.72E-10 -2.55E-01 -6.78E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.02E-01 4.94E-01 1.36E+00
Aortic stenosis BB70 Calcified aortic valve 9.08E-01 -1.40E-01 -3.02E-01
Apnea 7A40 Hyperplastic tonsil 6.34E-01 3.24E-02 1.40E-01
Arthropathy FA00-FA5Z Peripheral blood 5.59E-01 -9.52E-02 -5.50E-01
Asthma CA23 Nasal and bronchial airway 5.20E-03 1.95E-01 4.51E-01
Atopic dermatitis EA80 Skin 1.32E-07 -4.84E-01 -1.42E+00
Autism 6A02 Whole blood 2.36E-01 5.54E-02 3.51E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.86E-01 4.04E-02 2.63E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.21E-01 4.80E-03 2.16E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.68E-04 -1.28E-01 -4.88E-01
Batten disease 5C56.1 Whole blood 4.41E-01 -8.63E-02 -4.41E-01
Behcet's disease 4A62 Peripheral blood 9.76E-01 7.23E-02 3.42E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.96E-01 3.89E-02 2.07E-01
Bladder cancer 2C94 Bladder tissue 4.68E-06 -1.07E+00 -4.04E+00
Breast cancer 2C60-2C6Z Breast tissue 7.82E-20 -5.82E-01 -5.95E-01
Cardioembolic stroke 8B11.20 Whole blood 2.05E-04 -2.98E-01 -1.40E+00
Cervical cancer 2C77 Cervical tissue 1.05E-03 1.21E-01 5.12E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.69E-01 4.52E-02 9.35E-02
Chronic hepatitis C 1E51.1 Whole blood 9.07E-01 -1.89E-02 -2.31E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.77E-01 -9.80E-02 -2.78E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.79E-03 -1.09E-01 -4.81E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.33E-01 -8.14E-02 -4.80E-01
Colon cancer 2B90 Colon tissue 1.60E-13 2.49E-01 6.24E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.32E-01 1.62E-01 6.45E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.16E-01 -6.76E-02 -1.99E-01
Endometriosis GA10 Endometrium tissue 9.96E-01 -1.52E-01 -3.75E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.92E-01 -1.68E-02 -1.41E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.78E-03 4.05E-01 1.25E+00
Gastric cancer 2B72 Gastric tissue 1.01E-01 6.39E-01 1.71E+00
Glioblastopma 2A00.00 Nervous tissue 5.03E-03 -9.89E-02 -2.02E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.09E-01 7.76E-02 4.69E+03
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.64E-05 5.32E-01 1.96E+00
Head and neck cancer 2D42 Head and neck tissue 1.47E-02 4.37E-02 1.93E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.63E-01 -1.27E-01 -5.45E-01
Huntington's disease 8A01.10 Whole blood 7.08E-01 -4.94E-02 -5.57E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.65E-02 -3.19E-01 -1.28E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.70E-01 -4.91E-02 -4.37E-01
Influenza 1E30 Whole blood 6.94E-02 -5.68E-01 -1.79E+00
Interstitial cystitis GC00.3 Bladder tissue 1.72E-02 -2.54E-01 -1.71E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.52E-02 -1.78E-01 -7.92E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.49E-01 -6.10E-02 -2.77E-01
Ischemic stroke 8B11 Peripheral blood 1.32E-01 -1.92E-01 -6.66E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.66E-01 3.20E-02 1.17E-01
Lateral sclerosis 8B60.4 Skin 3.84E-01 -7.43E-02 -1.12E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 9.94E-02 -2.40E-01 -1.07E+00
Liver cancer 2C12.0 Liver tissue 7.86E-04 -2.96E-01 -8.60E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.78E-03 -5.13E-01 -1.54E+00
Lung cancer 2C25 Lung tissue 5.61E-04 -1.54E-01 -2.84E-01
Lupus erythematosus 4A40 Whole blood 7.48E-01 5.39E-02 1.03E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.31E-01 8.45E-03 4.59E-02
Major depressive disorder 6A70-6A7Z Whole blood 8.22E-01 4.10E-02 1.69E-01
Melanoma 2C30 Skin 2.12E-03 -7.46E-01 -9.57E-01
Multiple myeloma 2A83.1 Peripheral blood 2.32E-01 -1.85E-01 -5.80E-01
Multiple myeloma 2A83.1 Bone marrow 9.09E-04 3.63E-01 2.12E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.04E-01 -2.18E-01 -5.46E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.55E-01 -4.63E-02 -1.13E-01
Myelofibrosis 2A20.2 Whole blood 5.76E-04 -2.05E-01 -2.05E+00
Myocardial infarction BA41-BA50 Peripheral blood 7.66E-06 -5.72E-01 -9.88E-01
Myopathy 8C70.6 Muscle tissue 4.90E-01 -2.70E-01 -5.97E-01
Neonatal sepsis KA60 Whole blood 6.48E-01 1.99E-02 6.98E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.27E-03 7.26E-01 1.70E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.25E-02 3.32E-01 1.07E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.84E-01 8.96E-02 3.38E-01
Olive pollen allergy CA08.00 Peripheral blood 6.42E-01 4.79E-02 1.22E-01
Oral cancer 2B6E Oral tissue 5.65E-04 3.47E-01 7.45E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.59E-01 5.34E-05 2.82E-04
Osteoporosis FB83.1 Bone marrow 4.78E-01 -8.77E-03 -2.50E-02
Ovarian cancer 2C73 Ovarian tissue 1.94E-01 2.33E-01 4.15E-01
Pancreatic cancer 2C10 Pancreas 1.76E-02 4.26E-01 9.96E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.51E-01 8.36E-03 4.18E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.58E-01 5.11E-02 2.14E-01
Pituitary cancer 2D12 Pituitary tissue 8.64E-05 4.75E-01 1.74E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.36E-04 4.54E-01 2.78E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.09E-01 7.91E-02 7.48E-01
Polycythemia vera 2A20.4 Whole blood 6.75E-07 -1.12E-01 -9.72E-01
Pompe disease 5C51.3 Biceps muscle 1.61E-08 -9.95E-01 -4.94E+00
Preterm birth KA21.4Z Myometrium 5.93E-01 1.91E-01 3.71E-01
Prostate cancer 2C82 Prostate 1.24E-05 8.87E-01 1.30E+00
Psoriasis EA90 Skin 1.04E-11 -4.04E-01 -9.33E-01
Rectal cancer 2B92 Rectal colon tissue 4.25E-01 2.61E-01 7.75E-01
Renal cancer 2C90-2C91 Kidney 9.49E-03 5.96E-01 1.08E+00
Retinoblastoma 2D02.2 Uvea 9.61E-01 -5.85E-02 -2.69E-01
Rheumatoid arthritis FA20 Synovial tissue 1.27E-01 2.45E-01 8.77E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.98E-01 5.69E-02 3.22E-01
Schizophrenia 6A20 Prefrontal cortex 1.38E-02 -2.65E-01 -6.12E-01
Schizophrenia 6A20 Superior temporal cortex 6.53E-01 -8.67E-03 -5.91E-02
Scleroderma 4A42.Z Whole blood 4.30E-02 -1.52E-01 -1.48E+00
Seizure 8A60-8A6Z Whole blood 1.19E-01 -2.63E-01 -1.39E+00
Sensitive skin EK0Z Skin 7.17E-01 1.80E-01 4.32E-01
Sepsis with septic shock 1G41 Whole blood 3.59E-08 -1.44E-01 -5.59E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.91E-01 -4.17E-01 -6.80E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.01E-03 5.37E-01 1.35E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.15E-01 -1.30E-01 -9.53E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.73E-01 8.10E-02 3.32E-01
Skin cancer 2C30-2C3Z Skin 5.77E-31 -5.49E-01 -1.15E+00
Thrombocythemia 3B63 Whole blood 1.35E-02 -5.52E-02 -5.25E-01
Thrombocytopenia 3B64 Whole blood 6.65E-01 -1.96E-01 -5.46E-01
Thyroid cancer 2D10 Thyroid 1.91E-04 -1.88E-01 -5.19E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.24E-02 -2.86E-01 -8.24E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.88E-02 -5.27E-01 -2.72E+00
Type 2 diabetes 5A11 Liver tissue 6.51E-01 -7.32E-03 -6.18E-02
Ureter cancer 2C92 Urothelium 7.86E-01 1.83E-02 2.39E-01
Uterine cancer 2C78 Endometrium tissue 4.11E-03 7.69E-02 1.61E-01
Vitiligo ED63.0 Skin 2.09E-01 5.14E-02 2.60E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 VKORC1L1, an enzyme rescuing the vitamin K 2,3-epoxide reductase activity in some extrahepatic tissues during anticoagulation therapy. J Biol Chem. 2013 Oct 4;288(40):28733-42.