Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DES9MCU)

DME Name Kynurenine aminotransferase I (KYAT1)
Synonyms
Glutamine transaminase K; Glutamine--phenylpyruvate transaminase; Cysteine-S-conjugate beta-lyase; Kynurenine aminotransferase 1; Kynurenine--oxoglutarate transaminase 1; Kynurenine--oxoglutarate transaminase I; CCBL1; GTK; KATI; KYAT1
Gene Name KYAT1
UniProt ID
KAT1_HUMAN
INTEDE ID
DME0160
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
883
EC Number EC: 2.6.1.7
Transferase
Transaminase
Transaminase
EC: 2.6.1.7
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFML
NQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVII
IEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVL
NTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTL
TIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFR
QPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDE
PYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV
EL
Function
This enzyme catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). It metabolizes the cysteine conjugates of certain halogenated alkenes and alkanes to form reactive metabolites. It also catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Cysteine and methionine metabolism (hsa00270 )
Metabolic pathways (hsa01100 )
Selenocompound metabolism (hsa00450 )
Tryptophan metabolism (hsa00380 )
Reactome Pathway
Phenylalanine metabolism (R-HSA-8964208 )
Tryptophan catabolism (R-HSA-71240 )
Glutamate and glutamine metabolism (R-HSA-8964539 )

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.38E-01 3.09E-03 1.63E-02
Alopecia ED70 Skin from scalp 2.35E-01 -8.38E-02 -3.87E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.31E-06 1.78E-01 7.69E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.37E-01 1.53E-02 1.21E-01
Aortic stenosis BB70 Calcified aortic valve 4.06E-01 -3.04E-01 -4.43E-01
Apnea 7A40 Hyperplastic tonsil 5.16E-01 -5.41E-02 -5.44E-01
Arthropathy FA00-FA5Z Peripheral blood 9.52E-01 4.73E-02 2.31E-01
Asthma CA23 Nasal and bronchial airway 1.58E-02 9.61E-02 1.79E-01
Atopic dermatitis EA80 Skin 6.43E-02 -8.56E-02 -8.17E-01
Autism 6A02 Whole blood 9.78E-01 3.69E-02 1.44E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.21E-02 -1.72E-01 -8.41E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.40E-01 3.88E-01 1.23E+00
Bacterial infection of gingival 1C1H Gingival tissue 5.46E-05 -1.04E-01 -4.59E-01
Batten disease 5C56.1 Whole blood 6.53E-01 6.22E-02 5.02E-01
Behcet's disease 4A62 Peripheral blood 9.80E-01 6.51E-02 3.44E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.34E-01 8.06E-03 3.87E-02
Bladder cancer 2C94 Bladder tissue 5.29E-02 -5.43E-01 -1.29E+00
Breast cancer 2C60-2C6Z Breast tissue 6.48E-12 1.03E-01 4.56E-01
Cardioembolic stroke 8B11.20 Whole blood 4.40E-02 -1.28E-01 -3.64E-01
Cervical cancer 2C77 Cervical tissue 3.35E-01 -6.30E-02 -3.22E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.81E-01 -6.79E-02 -3.78E-01
Chronic hepatitis C 1E51.1 Whole blood 7.17E-01 9.63E-02 3.58E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.99E-01 8.18E-02 4.33E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.09E-03 1.87E-01 9.84E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.68E-01 1.15E-01 1.10E+00
Colon cancer 2B90 Colon tissue 1.36E-01 -3.72E-03 -1.55E-02
Coronary artery disease BA80-BA8Z Peripheral blood 7.51E-01 -2.01E-01 -9.24E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.91E-01 8.32E-02 1.17E-01
Endometriosis GA10 Endometrium tissue 3.41E-01 -2.11E-02 -8.27E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.36E-01 7.89E-02 2.87E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.40E-01 -7.61E-02 -3.42E-01
Gastric cancer 2B72 Gastric tissue 7.33E-01 -1.90E-01 -5.22E-01
Glioblastopma 2A00.00 Nervous tissue 5.89E-13 -1.87E-01 -5.29E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 9.88E-02 5.11E-01 2.91E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.16E-01 -1.62E-01 -9.44E-01
Head and neck cancer 2D42 Head and neck tissue 2.68E-11 1.88E-01 7.80E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.43E-01 -4.55E-03 -4.29E-02
Huntington's disease 8A01.10 Whole blood 2.79E-01 -7.38E-02 -8.68E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.65E-01 -7.67E-02 -4.48E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.75E-01 7.18E-02 5.93E-01
Influenza 1E30 Whole blood 5.76E-02 1.21E-01 7.77E-01
Interstitial cystitis GC00.3 Bladder tissue 3.36E-01 -3.55E-01 -9.72E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.07E-01 -1.67E-01 -3.29E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.05E-01 8.93E-02 3.80E-01
Ischemic stroke 8B11 Peripheral blood 6.08E-01 1.37E-02 6.89E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 6.47E-01 -9.31E-03 -2.87E-02
Lateral sclerosis 8B60.4 Skin 2.38E-01 -1.92E-01 -1.35E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 3.61E-01 1.90E-01 6.41E-01
Liver cancer 2C12.0 Liver tissue 6.04E-04 8.16E-02 3.79E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.33E-02 2.46E-01 8.76E-01
Lung cancer 2C25 Lung tissue 1.67E-18 1.37E-01 7.01E-01
Lupus erythematosus 4A40 Whole blood 1.01E-01 -1.17E-01 -2.81E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.08E-01 -7.38E-03 -3.57E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.12E-01 -2.82E-02 -1.12E-01
Melanoma 2C30 Skin 8.15E-01 -8.39E-02 -2.26E-01
Multiple myeloma 2A83.1 Peripheral blood 2.54E-01 3.12E-02 2.12E-01
Multiple myeloma 2A83.1 Bone marrow 5.35E-04 1.64E-01 1.52E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.31E-01 2.99E-01 5.64E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.80E-01 -7.26E-02 -2.77E-01
Myelofibrosis 2A20.2 Whole blood 4.87E-01 -6.16E-02 -3.70E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.79E-01 -1.57E-01 -2.60E-01
Myopathy 8C70.6 Muscle tissue 1.11E-01 -1.48E-01 -7.04E-01
Neonatal sepsis KA60 Whole blood 5.24E-11 -1.53E-01 -6.18E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.29E-01 -4.09E-02 -1.04E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.43E-01 -4.77E-03 -3.30E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.98E-01 7.04E-02 5.37E-01
Olive pollen allergy CA08.00 Peripheral blood 8.75E-01 4.65E-02 1.33E-01
Oral cancer 2B6E Oral tissue 3.51E-02 -1.97E-01 -5.13E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.68E-01 3.30E-02 2.81E-01
Osteoporosis FB83.1 Bone marrow 3.04E-01 1.72E-02 1.24E-01
Ovarian cancer 2C73 Ovarian tissue 2.61E-02 -4.56E-01 -8.05E-01
Pancreatic cancer 2C10 Pancreas 4.01E-01 -1.93E-01 -7.65E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.93E-01 2.30E-02 1.76E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.09E-01 -2.91E-02 -2.80E-01
Pituitary cancer 2D12 Pituitary tissue 6.31E-04 -3.97E-01 -9.80E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.05E-02 -2.79E-01 -5.35E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.82E-01 -9.48E-03 -6.72E-02
Polycythemia vera 2A20.4 Whole blood 3.94E-03 -9.85E-02 -8.68E-01
Pompe disease 5C51.3 Biceps muscle 2.55E-02 -1.67E-01 -6.63E-01
Preterm birth KA21.4Z Myometrium 6.02E-01 -4.78E-02 -3.63E-01
Prostate cancer 2C82 Prostate 2.94E-01 5.36E-02 1.09E-01
Psoriasis EA90 Skin 1.03E-02 -1.74E-01 -4.46E-01
Rectal cancer 2B92 Rectal colon tissue 6.21E-01 -3.22E-02 -1.25E-01
Renal cancer 2C90-2C91 Kidney 4.08E-02 -1.43E-01 -3.56E-01
Retinoblastoma 2D02.2 Uvea 1.07E-06 -4.93E-01 -2.33E+00
Rheumatoid arthritis FA20 Synovial tissue 1.03E-01 -2.46E-01 -5.29E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.45E-01 7.72E-03 6.09E-02
Schizophrenia 6A20 Prefrontal cortex 1.34E-01 1.36E-02 6.11E-02
Schizophrenia 6A20 Superior temporal cortex 1.43E-01 -5.72E-02 -3.92E-01
Scleroderma 4A42.Z Whole blood 4.15E-06 -3.71E-01 -2.61E+00
Seizure 8A60-8A6Z Whole blood 7.55E-01 9.68E-02 5.59E-01
Sensitive skin EK0Z Skin 8.63E-01 -1.21E-02 -9.82E-02
Sepsis with septic shock 1G41 Whole blood 9.28E-02 1.97E-02 7.61E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.70E-01 3.00E-02 2.78E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.64E-01 4.27E-02 5.03E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.03E-01 6.85E-02 1.66E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.61E-01 -2.55E-01 -1.46E+00
Skin cancer 2C30-2C3Z Skin 5.76E-03 -1.42E-01 -4.04E-01
Thrombocythemia 3B63 Whole blood 2.33E-01 2.18E-04 1.42E-03
Thrombocytopenia 3B64 Whole blood 2.19E-01 3.32E-01 6.16E-01
Thyroid cancer 2D10 Thyroid 6.61E-01 -8.21E-03 -3.60E-02
Tibial muscular dystrophy 8C75 Muscle tissue 3.35E-05 -3.77E-01 -1.85E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.35E-01 -9.54E-02 -7.90E-01
Type 2 diabetes 5A11 Liver tissue 8.39E-01 -5.16E-02 -2.78E-01
Ureter cancer 2C92 Urothelium 2.91E-02 2.00E-01 8.14E-01
Uterine cancer 2C78 Endometrium tissue 9.75E-01 -2.56E-02 -7.22E-02
Vitiligo ED63.0 Skin 4.20E-01 -1.26E-02 -5.68E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases