Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DESA9EX)

DME Name Inositol polyphosphate multikinase (IPMK)
Synonyms Inositol 1,3,4,6-tetrakisphosphate 5-kinase; IMPK; IPMK
Gene Name IPMK
UniProt ID
IPMK_HUMAN
INTEDE ID
DME0505
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
253430
EC Number EC: 2.7.1.151
Transferase
Kinase
Phosphotransferase
EC: 2.7.1.151
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MATEPPSPLRVEAPGPPEMRTSPAIESTPEGTPQPAGGRLRFLNGCVPLSHQVAGHMYGK
DKVGILQHPDGTVLKQLQPPPRGPRELEFYNMVYAADCFDGVLLELRKYLPKYYGIWSPP
TAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLG
MRVYHVHSDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKILQWF
ENQKQLNFYASSLLFVYEGSSQPTTTKLNDRTLAEKFLSKGQLSDTEVLEYNNNFHVLSS
TANGKIESSVGKSLSKMYARHRKIYTKKHHSQTSLKVENLEQDNGWKSMSQEHLNGNVLS
QLEKVFYHLPTGCQEIAEVEVRMIDFAHVFPSNTIDEGYVYGLKHLISVLRSILDN
Function
This enzyme has 3-kinase, 5-kinase and 6-kinase activities on phosphorylated inositol substrates and plays an important role in the biosynthesis of inositol 1,3,4,5,6-pentakisphosphate, and has a preferred 5-kinase activity.
KEGG Pathway
Inositol phosphate metabolism (hsa00562 )
Metabolic pathways (hsa01100 )
Phosphatidylinositol signaling system (hsa04070 )
Reactome Pathway
Synthesis of IPs in the nucleus (R-HSA-1855191 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
D-myo-inositol 1,4,5-trisphosphate DMNUKIX Discovery agent N.A. Investigative [1]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
D-myo-inositol 1,4,5-trisphosphate Discovery agent [N.A.] Investigative Km = 0.00028 microM [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.63E-01 -3.79E-02 -1.66E-01
Alopecia ED70 Skin from scalp 3.33E-03 1.45E-01 6.49E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.80E-01 -1.54E-03 -1.44E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 2.03E-01 1.52E-01 8.59E-01
Aortic stenosis BB70 Calcified aortic valve 6.41E-01 -2.18E-02 -8.69E-02
Apnea 7A40 Hyperplastic tonsil 4.97E-01 2.89E-01 1.34E+00
Arthropathy FA00-FA5Z Peripheral blood 8.50E-02 3.41E-01 1.18E+00
Asthma CA23 Nasal and bronchial airway 5.51E-03 -1.20E-01 -1.33E-01
Atopic dermatitis EA80 Skin 2.11E-03 1.50E-01 7.28E-01
Autism 6A02 Whole blood 9.59E-02 7.41E-02 2.97E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.98E-01 4.62E-01 1.79E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.12E-02 -6.81E-01 -1.42E+00
Bacterial infection of gingival 1C1H Gingival tissue 7.49E-01 -1.95E-02 -8.53E-02
Batten disease 5C56.1 Whole blood 3.17E-01 -2.56E-02 -2.37E-01
Behcet's disease 4A62 Peripheral blood 8.90E-01 -1.87E-03 -6.29E-03
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.07E-03 8.73E-02 8.90E-01
Bladder cancer 2C94 Bladder tissue 1.35E-01 -1.37E-01 -9.61E-01
Breast cancer 2C60-2C6Z Breast tissue 6.83E-03 -7.79E-02 -2.64E-01
Cardioembolic stroke 8B11.20 Whole blood 3.58E-03 1.43E-01 3.99E-01
Cervical cancer 2C77 Cervical tissue 6.74E-01 -6.95E-02 -2.06E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.46E-01 -5.54E-02 -6.96E-02
Chronic hepatitis C 1E51.1 Whole blood 1.91E-01 3.82E-02 2.34E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.17E-01 -7.32E-02 -4.29E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.82E-01 -1.74E-02 -8.73E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.18E-01 -2.47E-01 -7.28E-01
Colon cancer 2B90 Colon tissue 2.26E-17 -2.62E-01 -8.96E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.67E-01 -1.73E-02 -8.89E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.44E-01 -1.03E-01 -5.87E-01
Endometriosis GA10 Endometrium tissue 9.71E-01 -1.43E-02 -6.20E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.28E-01 1.85E-02 1.89E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.76E-02 2.22E-01 1.27E+00
Gastric cancer 2B72 Gastric tissue 1.20E-01 1.99E-01 1.34E+00
Glioblastopma 2A00.00 Nervous tissue 1.44E-15 1.40E-01 6.27E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.24E-01 -1.13E-01 -4.53E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.81E-01 -1.33E-01 -2.80E-01
Head and neck cancer 2D42 Head and neck tissue 1.76E-04 -1.52E-01 -6.80E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.07E-01 -1.67E-02 -2.19E-01
Huntington's disease 8A01.10 Whole blood 1.77E-01 -1.04E-01 -8.81E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.73E-02 -1.86E-01 -8.20E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.68E-02 -1.33E-01 -1.09E+00
Influenza 1E30 Whole blood 9.45E-02 -3.85E-01 -1.50E+00
Interstitial cystitis GC00.3 Bladder tissue 4.52E-01 -2.26E-02 -2.15E-01
Intracranial aneurysm 8B01.0 Intracranial artery 5.24E-01 1.00E-01 4.30E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.66E-01 -4.64E-02 -1.86E-01
Ischemic stroke 8B11 Peripheral blood 5.93E-01 -3.06E-02 -1.19E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.92E-07 1.64E-01 4.99E-01
Lateral sclerosis 8B60.4 Skin 1.45E-01 -1.06E-01 -7.23E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.83E-02 1.05E-01 4.63E-01
Liver cancer 2C12.0 Liver tissue 7.58E-01 -2.45E-02 -1.53E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.35E-03 -2.59E-01 -1.70E+00
Lung cancer 2C25 Lung tissue 1.55E-15 1.66E-01 8.47E-01
Lupus erythematosus 4A40 Whole blood 4.45E-05 4.99E-01 6.79E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.22E-02 3.67E-02 3.80E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.18E-01 4.28E-02 8.45E-02
Melanoma 2C30 Skin 1.79E-02 -4.67E-01 -7.41E-01
Multiple myeloma 2A83.1 Peripheral blood 7.57E-01 1.84E-02 1.12E-01
Multiple myeloma 2A83.1 Bone marrow 9.66E-05 3.55E-01 2.30E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.24E-01 5.25E-02 9.75E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.63E-07 -1.94E-01 -1.27E+00
Myelofibrosis 2A20.2 Whole blood 9.81E-01 1.14E-01 5.10E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.60E-01 1.92E-02 5.16E-02
Myopathy 8C70.6 Muscle tissue 4.33E-01 5.47E-02 4.31E-01
Neonatal sepsis KA60 Whole blood 1.12E-15 3.52E-01 1.29E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.47E-09 7.39E-01 4.59E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.82E-01 3.70E-02 5.32E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.76E-01 -9.01E-03 -9.06E-02
Olive pollen allergy CA08.00 Peripheral blood 7.70E-01 -1.42E-01 -5.80E-01
Oral cancer 2B6E Oral tissue 2.82E-02 1.58E-01 5.50E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.52E-01 -6.32E-02 -1.62E-01
Osteoporosis FB83.1 Bone marrow 3.62E-01 9.22E-02 6.66E-01
Ovarian cancer 2C73 Ovarian tissue 1.95E-03 2.89E-01 1.39E+00
Pancreatic cancer 2C10 Pancreas 2.60E-01 -5.24E-02 -2.85E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.26E-01 5.05E-02 6.14E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.13E-03 2.42E-01 1.28E+00
Pituitary cancer 2D12 Pituitary tissue 4.46E-01 3.38E-03 2.22E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.03E-01 -3.92E-02 -2.65E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.60E-01 -7.97E-03 -1.10E-01
Polycythemia vera 2A20.4 Whole blood 2.49E-13 4.66E-01 2.08E+00
Pompe disease 5C51.3 Biceps muscle 7.64E-03 -1.38E-01 -9.92E-01
Preterm birth KA21.4Z Myometrium 8.03E-01 -7.39E-02 -5.48E-01
Prostate cancer 2C82 Prostate 3.69E-04 1.13E+00 1.22E+00
Psoriasis EA90 Skin 3.15E-06 2.72E-01 7.67E-01
Rectal cancer 2B92 Rectal colon tissue 4.51E-01 -2.92E-03 -1.18E-02
Renal cancer 2C90-2C91 Kidney 1.64E-05 2.94E-01 2.02E+00
Retinoblastoma 2D02.2 Uvea 4.38E-04 -3.13E-01 -2.22E+00
Rheumatoid arthritis FA20 Synovial tissue 6.55E-02 -3.51E-01 -1.10E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.17E-01 1.65E-02 1.20E-01
Schizophrenia 6A20 Prefrontal cortex 1.56E-01 4.59E-02 1.58E-01
Schizophrenia 6A20 Superior temporal cortex 3.19E-01 2.87E-02 2.88E-01
Scleroderma 4A42.Z Whole blood 2.39E-01 7.17E-03 3.60E-02
Seizure 8A60-8A6Z Whole blood 2.31E-01 2.85E-02 8.73E-02
Sensitive skin EK0Z Skin 9.84E-01 4.52E-02 3.51E-01
Sepsis with septic shock 1G41 Whole blood 5.95E-10 1.69E-01 5.99E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.87E-01 -1.21E-01 -3.43E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.58E-01 1.68E-02 1.69E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.99E-02 4.91E-01 2.24E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.97E-03 3.37E-01 3.36E+00
Skin cancer 2C30-2C3Z Skin 9.33E-01 -2.46E-01 -5.80E-01
Thrombocythemia 3B63 Whole blood 3.55E-03 2.84E-01 1.35E+00
Thrombocytopenia 3B64 Whole blood 5.58E-01 -4.13E-03 -4.69E-03
Thyroid cancer 2D10 Thyroid 1.59E-03 -1.11E-01 -6.50E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.43E-02 -9.06E-02 -8.10E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.30E-01 -8.12E-02 -9.13E-01
Type 2 diabetes 5A11 Liver tissue 9.89E-01 6.92E-02 3.93E-01
Ureter cancer 2C92 Urothelium 6.73E-01 -1.03E-02 -9.82E-02
Uterine cancer 2C78 Endometrium tissue 7.15E-24 4.82E-01 1.54E+00
Vitiligo ED63.0 Skin 2.76E-01 6.91E-02 5.02E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The human homologue of yeast ArgRIII protein is an inositol phosphate multikinase with predominantly nuclear localization. Biochem J. 2002 Sep 1;366(Pt 2):549-56.